KEGG   Chlamydia trachomatis L1/1322/p2: L11322_00790Help
Entry
L11322_00790      CDS       T02557                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ctrp  Chlamydia trachomatis L1/1322/p2
Pathway
ctrp00860  Porphyrin and chlorophyll metabolism
ctrp01100  Metabolic pathways
ctrp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctrp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L11322_00790
Enzymes [BR:ctrp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     L11322_00790
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     L11322_00790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO Thi4 FAD_binding_3 FAD_binding_2 NAD_binding_9 Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CCP63681
Position
complement(863735..865009)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHVQLSILEKESRSGGLIVTEKQQGFSLNMGPKGFV
LAHDGQHTLHLIQSLGLADELLYSSPEAKNRFIHYNNKTRKVSPWTIFKQNLPLSFAKDF
FARPYKQDSSVEAFFKRHSSSKLRRNLLNPISIAIRAGHSHILSAQMAYPELTRREAQTG
SLLRSYLKDFPKEKRTGPYLATLRSGMGMLTQALHDKLPATWYFSAPVSKIRQLANGKIS
LSSPQGEITGDMLIYAGSVHDLPSCLEEIPETKLIKQTTSSWDLSCVSLGWHASLPIPHG
YGMLFADTPPLLGIVFNTEVFPQPERPNTIVSLLLEGRWHQEEAYAFSLAAISEYLQIYT
PPQAFSLFSPREGLPQHHVGFIQSRQRLLSKLPHNIKIVGQNFAGPGLNRATASAYKAIA
SLLP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgctctcattgttggctcaggtattgccggcctttctgccgcgtggtggcta
cacaaacgattccctcatgtgcagttgtctattctagaaaaagagtctcgatctggaggg
ctaattgtcacagagaaacaacaagggttttccctcaatatgggccctaaaggttttgtt
ttagctcatgatgggcaacacacccttcacctcattcagtctttaggcctagcagacgag
ctattatatagctctccagaggctaaaaaccgctttatccactataataataaaacccga
aaagtctcgccttggactattttcaaacaaaatctccctctctcttttgctaaggatttc
tttgcgcgtccttacaaacaagacagctccgtggaagccttctttaaaagacacagttct
tccaagcttagaagaaatcttttaaatcccattagcattgctattcgtgcaggacatagt
catatattgtctgcacagatggcttacccagaattaacgcgaagagaagctcaaacagga
tcgttgttacgtagttatctcaaagattttcctaaagagaaacgcacaggcccttattta
gctaccttgcggtctgggatgggaatgctaacccaggctttgcatgataaattgcctgct
acctggtatttttctgcacccgtcagcaaaatccgtcagttggcgaacgggaaaatttct
ctttcatctcctcaaggagaaataacgggagatatgctcatttatgctgggtccgtgcac
gatctcccttcctgtctagaagagatccctgaaaccaagcttatcaagcaaacgacttca
tcttgggatctctcttgtgtatctttaggatggcatgcatccctccctatccctcatgga
tatggcatgcttttcgctgatacgcctcccttattagggatcgtgtttaatacggaagtg
ttccctcaacccgagcggcctaatacaatagtctctcttcttttagaaggtcgatggcac
caagaagaagcgtatgctttctcactagcagctatttctgagtacctgcaaatttacact
cctccccaagctttctcactattctctcctcgagagggacttccccaacaccatgttgga
tttatccaatcccgccaacgccttctatctaaacttcctcacaatataaaaattgtaggg
cagaattttgcaggtccaggtctcaaccgcgctacagcgtctgcttataaagctatagct
tctttactaccatga

DBGET integrated database retrieval system