KEGG   Chlamydia trachomatis A/363: A363_00466Help
Entry
A363_00466        CDS       T02562                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctrq  Chlamydia trachomatis A/363
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctrq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505076..505747
Genome map
AA seq 223 aa AA seqDB search
MPLYLGLNPSSAKQYSAVFQPIIRIVPFSKHVPQIRHARKFLVSTSHILLTSPSSTACFF
SSIRKRIPLSLFRNKSFVTIGEATSSRVKAFLPKANIVQSAFPQAEAFLPILSTLPSSSS
LLYPHSVLARPILRSLLQTLPFSSFSYPHYTVKPITLSVSTFLPHKTIILTSPSIVRAYA
QLFPCLPDKEHWCLGEISAAEFKQIFHTPPSKILFSTKEPTGC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtacttaggcctcaatccatcctctgctaaacaatattctgctgtttttcag
cctattattcgcatagtccctttttcaaaacacgttcctcaaatacgacatgctaggaag
ttccttgtatcaacttcccatattttgttaacaagcccctcttctaccgcttgttttttt
tcttccattaggaaaagaatccctttatccctgttcaggaataaatccttcgttaccata
ggagaagccacttcttctcgtgtaaaggcctttctccccaaagctaatattgtgcaaagc
gcattccctcaagcagaagcatttcttcccatcctatcgactcttccttccagctcctcc
ctactctatcctcactctgtactcgctcgtcccattctccgctctcttctacaaacactc
cctttctcctccttttcctatcctcattacacagttaaacccattacactttccgtaagt
acctttcttccccataaaactattattctcactagcccttctatcgttcgtgcctatgca
caactatttccctgcctccctgataaagaacactggtgtctaggagagattagtgcagca
gaattcaaacagatatttcacactcctccttccaaaattcttttttcaactaaagaaccg
acaggatgttga

DBGET integrated database retrieval system