KEGG   Chlamydia trachomatis A/7249: A7249_00089Help
Entry
A7249_00089       CDS       T02564                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctrz  Chlamydia trachomatis A/7249
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ctrz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100589..102172)
Genome map
AA seq 527 aa AA seqDB search
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLHTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREHL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHVVGLFRFWVWDESGCGRFEPHDPKNYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccatcattatcccaatcccgacgtatcatccagcaatcttccattcgaaagatttgg
aatcagatagatacttctcctaagcatggcgtatgtgtaccgttattttctctccatact
caagaaagttgtgggataggtgaatttcttgacctgattcctatgatcgattggtgtatc
tcgtgtggttttcaaatccttcaaattcttccgattaacgatacagggtcctgttcgagt
ccttacaatagcatttcttcgatagcactcaatcctcttcacctttctatctctgcgctc
ccctataaagaagaagtgccagctgcggaaacacgcatacgagaaatgcagcaactctct
caacttcctcaagtacattatgaaaaagttcgctctatgaagagagatttttttcaagag
tactaccgcgtgtgtaaacagaaaaaactcactgatcatcctgatttttatgccttctgt
gaacaggaaaaatattggttacatccctacgctctctttcgctctatccgagaacatttg
gataaccttcctattaatcattggccaaccacctacacagatctctcccagattaccgag
catgaacgtacttttgcggaagatatacaatttcactcttatctacagtatttgtgcttc
caacagatgacacaagtgcgggagcatgccaattgcaaaagctgtctcatcaaaggggat
atccctattctaatcagtaaagatagctgcgatgtctggttttataggcattacttttcc
tcttcagaatctgtaggtgctcctcctgacctgtataatgcggaaggtcagaactggcat
ctccccatttataatatgaaaactttgcaacaagataactacctctggtggaaggagcgc
ttacgttatgcggagaatttttactctttataccgtcttgatcatgtcgtcggtctcttt
cgattttgggtatgggatgagtctggatgcggacgctttgaacctcatgatccgaaaaac
tatctagctcaagggcaagatatcttatctcacctcttgaccagttcatctatgctacct
ataggagaagatctgggaacgatcccttccgatgtgaaacgtatgctcgagtcttttgcc
gtatgcggcactagaattcctcgttgggaacgaaactgggaagggaatggagcctatacc
cctttcgatcaatacgaccctctatccgtcacaagcctctctactcatgattcctctaca
ttagcctcatggtggaaagaatctcctcaggaatccaaactatttgctcagtttttagga
ctcccctattcttccaccctatctcttcacaatcataccgaaatcctgaaactctctcac
aaaacctcttctatttttcgcatcaatcttattaatgactatctggctctgttcccggat
ttgatatcaaaaactcctcgctacgaaagaatcaatctgccaggaactatttcaaaaaat
aattgggtgtatcgagttaagccttctattgaagatttatcctctcattctaagctaaat
tctttacttgaggctctattttag

DBGET integrated database retrieval system