KEGG   Chloroherpeton thalassium: Ctha_0034Help
Entry
Ctha_0034         CDS       T00726                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00051  Fructose and mannose metabolism
cts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ctha_0034
Enzymes [BR:cts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ctha_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II SpoVG
Motif
Other DBs
NCBI-ProteinID: ACF12506
JGI: Ctha0034
UniProt: B3QSB5
Position
46157..46942
Genome map
AA seq 261 aa AA seqDB search
MNIALQEEVVRFTRKVAEHGFVASFDGNLSLRSSEGIYITATRTLKSDATTSDICLIDLD
GNLLEGERKPSSETLMHLLIYRERPDVMGVVHTHAPYATAFASARQPLDAAVFPEVILDI
GPVPLAEYATPSTEDVPNSLKPAIAWANGILLANHGLVCMGGSLAEAFFRTEKLEHAAKT
LIAAQTLGGAVPLKRCEVDYLYETHQTFKRRGVLMDCESLDHPSCRTSDDREKLVCHPSD
KNCREEFISKTAHAVLKRLKG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgcacttcaagaagaagttgttcgtttcacaagaaaggtcgcggagcacggc
tttgtggccagctttgacggcaaccttagcctaagaagttcggaaggcatctacattacc
gcaacccgcacgctcaaatccgatgccaccaccagcgatatttgcctcattgaccttgac
ggaaatcttttggaaggtgaacgcaagccatcgagcgaaaccttgatgcaccttttgatt
tatcgcgaacgcccggatgtgatgggcgtggttcatacgcacgcaccctatgccacggcg
tttgcgtccgctcgccaaccgctcgacgcagccgtttttcccgaagtcattttggacatc
ggtcctgttccactcgccgaatacgccacgcccagcacagaagacgtgccaaactcgctc
aaacctgccatcgcttgggcaaatggcattttgcttgccaatcatgggcttgtttgtatg
ggaggctcgcttgcggaagccttttttcgaacggaaaaattggagcatgctgcaaaaacc
ctgatcgctgcacaaacgctcggaggcgccgtgccactcaagcgctgcgaagtggattat
ctttacgaaacgcaccaaacctttaaacggcgcggtgttttgatggattgcgaatcgctt
gaccatccttcgtgcagaacttccgacgatagagaaaagctcgtttgccatccaagtgat
aaaaattgccgtgaggaatttatttcgaaaaccgctcacgccgttttgaaacgcttgaaa
ggttaa

DBGET integrated database retrieval system