KEGG   Chloroherpeton thalassium: Ctha_0057Help
Entry
Ctha_0057         CDS       T00726                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cts  Chloroherpeton thalassium
Brite
Enzymes [BR:cts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Ctha_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd NmrA Polysacc_synt_2 RmlD_sub_bind Ldh_1_N adh_short KR DapB_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACF12528
JGI: Ctha0057
UniProt: B3QSD7
Position
complement(67805..68830)
Genome map
AA seq 341 aa AA seqDB search
MPDIKILVTGATGYIGSALVLAIHRKYGKQVQIKALVRKNSPRHVLKGVPVEFIDGDVTV
PLSLWEATKNVDVVFHTAALVSYQQRDRRKLYKINVLGTRHLVDACLRNQVKKLIHTSSV
AAVGVIESGALNPESQAFEPWQHRYGYMAAKYLSELEVLRGTFEGLHTVMVNPGAVMGSY
PGSLYPVNSASSFIEDIYKGLIPFYPTGGVGFVDISDVVTAHLLAWERGENGERYNIVSE
NLTYKALFDLTTRVPGSRSRTAEPLNKWFGRVLGMGTEVMASVMRRTSTVTFDGVRLAEL
ALYFDNSKSKQALGLKYRPFVETVLDLLRASQATKPFLHKA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatataaaaattttagttacaggcgcgacaggatatatcggctcggccttggtg
ttagcgattcaccgaaagtacggcaagcaggttcagatcaaagcgcttgtccggaaaaat
tccccgcgccatgttttaaagggagtgcccgttgaattcattgatggggatgtcaccgtt
ccgttgtcattatgggaagccacaaaaaacgtggacgtggtttttcacacggcggcgttg
gtttcttatcagcagcgggatcggcgtaaattatataaaatcaatgtgctgggaacgcgt
catttggttgatgcgtgtttgcgaaatcaagtcaaaaaattgattcataccagctcggtg
gctgcggtcggcgtgatcgaaagtggcgcgttaaaccctgaaagtcaggcatttgagcct
tggcaacatcgttatggctacatggcggcgaagtatctttctgagttggaagtgcttcgc
ggaacatttgaagggttgcacacggtgatggttaatccgggcgcggtgatgggctcgtat
cctggtagtttgtatcccgtaaacagtgcatccagttttattgaggatatttataaaggc
ctaattccgttttatccgactggtggcgttggttttgtggatatttccgacgtggtaacc
gcgcatttgctggcatgggaacgaggcgaaaacggcgagcgctacaacattgtctcagaa
aatttaacctacaaagcgctttttgatctcacaacgcgcgttccaggaagtagaagccga
acagccgagccgctcaataagtggtttgggcgagtgcttggcatgggcactgaggtgatg
gccagtgtgatgcggcgcacatcaacagtcacatttgatggcgtaagattagccgaatta
gcgctatattttgataactcaaaatccaagcaggcgttagggcttaaatatcggcctttt
gtcgaaacggtgttagatttgctgagagcaagtcaagctaccaagccgtttcttcacaaa
gcatga

DBGET integrated database retrieval system