KEGG   Chloroherpeton thalassium: Ctha_0229Help
Entry
Ctha_0229         CDS       T00726                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ctha_0229
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_0229
   00620 Pyruvate metabolism
    Ctha_0229
   00640 Propanoate metabolism
    Ctha_0229
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ctha_0229
   00680 Methane metabolism
    Ctha_0229
Enzymes [BR:cts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ctha_0229
Lipid biosynthesis proteins [BR:cts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ctha_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
268688..270667
Genome map
AA seq 659 aa AA seqDB search
MPTNTESNAGISSVLHEQRVFKPGPEFSEGATIKSMDEYEKQYKIAADDPQKYWANVASQ
YHWFKKWDTVLEWNEPFSKWFVGGETNLCYNALDVHINTWRKNKAAIIWEGEPGDQRTLT
YLQLHREVSKFANVLKRRGIQKGDRVAIYMGMTPELVIAVLACARIGAVHNVIFAGFSAH
ALTERINDSHAKMIVCADGTIRRGKSLNLKEVVDEALVDTPSIQNVIVYQRTKETIHMQD
GRDHWWHDLMGLASEYCPAESLDSEHPLFILYTSGSTGKPKGILHSTGGYMTHVANSFKH
VFDVKEQDIYWCTADIGWITGHSYMIYGPLINGSTIVVYEGAPNYPQWDRFWDIIQRHKV
TIFYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPINPEAWMWYYKNVGKEKCPIVD
TWWQTETGGIMISPLPGATPLKPGTATRPLPGILVDVVHKDGTPCQANEGGFLVVKHPWP
SMLRTIYGDEERYKTTYWSEVDGMYFTGDGARKDNDGYIWIMGRVDDVVNISGHRLGTSE
VESALVSHEAVAEAAVVSRPDEVKGNALVAFVTLKEEFEGNQKLREELRAHVAKEIGPIA
KPDDVRWAAALPKTRSGKIMRRLLREMASSKEVKGDVTTLEDFTVLEKLREEEEESKKD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaacactgaatcaaacgcaggaatcagctctgttttgcacgagcagcgagtc
ttcaagcctggccctgagttttcagagggcgcaacgattaaatcgatggacgagtacgaa
aagcagtacaaaatcgccgctgatgatcctcaaaaatactgggcaaatgtggcctctcag
taccactggttcaaaaagtgggataccgttcttgagtggaacgagcctttttctaaatgg
tttgtaggtggcgagacgaacttatgctacaacgctctggacgtgcacatcaacacctgg
cggaaaaacaaagccgcgatcatttgggaaggtgaaccgggcgaccagcgcaccctgact
tatttgcagcttcatcgcgaagtgagcaaatttgccaacgtgctcaaacgccgcggcata
caaaaaggcgaccgtgtagcaatttacatgggcatgacccccgaactcgttatcgccgtt
cttgcctgtgcccgtattggcgcggttcacaacgtgatatttgccggcttctctgctcat
gcgctcaccgaacgcatcaacgactctcatgctaaaatgattgtttgtgcagatggcacg
attcgccgcggcaaaagcctcaacctcaaagaagtggttgatgaagcattagtcgataca
ccatccattcaaaacgtgattgtttatcagcgcacaaaagaaacgattcacatgcaagat
ggccgcgaccactggtggcacgacctcatgggactcgcttctgaatactgccctgctgag
tcactcgattccgaacatccactttttatcctttacaccagcggttctaccggaaagccg
aaaggtattcttcactccactggcggctatatgactcatgttgccaactccttcaagcac
gtttttgatgttaaagagcaagatatttattggtgcactgccgatattggttggattacc
ggccatagctacatgatctatgggccgctcatcaacggctcaaccatcgtggtctacgaa
ggcgcaccaaactacccgcaatgggatagattctgggacatcatccaacgccacaaagtc
accattttctacacagcgccaaccgctattcgtgccttcattcgcgctggagatgaatgg
gttaccaagcatgatctctcttcgcttcgcctgctcggcaccgttggagaaccgattaac
ccagaagcctggatgtggtactataaaaacgtgggcaaagaaaaatgccctatcgttgat
acttggtggcaaactgaaaccggcggcattatgatttctccgcttcctggtgccacgcca
ttgaaaccgggcactgccacgcgtccgcttcctggcattttagttgatgttgttcataaa
gatggcacgccttgccaagccaatgaaggtggatttttggtggtgaaacatccttggcca
tccatgcttcgcaccatttatggcgatgaagagcgctacaaaaccacttactggtcggaa
gtcgacggcatgtacttcactggcgacggtgcaagaaaagacaatgacggatacatttgg
atcatgggacgcgttgatgacgtggtcaatatttctggtcacagactcggcacaagtgaa
gttgaaagcgcccttgtttcgcatgaagctgttgcagaagctgctgtggtcagccgcccc
gatgaagttaaaggaaatgcgttggttgcattcgtaacgctgaaagaagagttcgaagga
aatcaaaaactccgcgaagagcttcgcgcgcatgtggccaaggaaatcggaccgattgcc
aaaccggacgatgttcgctgggctgccgcgttgccaaaaacacgcagcggaaaaatcatg
cgtcgcttgcttcgtgaaatggcctcaagcaaagaagttaagggcgacgttactacgctt
gaagactttaccgtgctcgaaaaacttcgcgaagaagaagaagagagcaaaaaggactaa

DBGET integrated database retrieval system