KEGG   Chloroherpeton thalassium: Ctha_0229Help
Entry
Ctha_0229         CDS       T00726                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00010  Glycolysis / Gluconeogenesis
cts00620  Pyruvate metabolism
cts00640  Propanoate metabolism
cts00680  Methane metabolism
cts00720  Carbon fixation pathways in prokaryotes
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01120  Microbial metabolism in diverse environments
cts01130  Biosynthesis of antibiotics
cts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_0229
   00620 Pyruvate metabolism
    Ctha_0229
   00640 Propanoate metabolism
    Ctha_0229
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ctha_0229
   00680 Methane metabolism
    Ctha_0229
Enzymes [BR:cts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ctha_0229
Lipid biosynthesis proteins [BR:cts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ctha_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACF12700
JGI: Ctha0229
UniProt: B3QTF4
Position
268688..270667
Genome map
AA seq 659 aa AA seqDB search
MPTNTESNAGISSVLHEQRVFKPGPEFSEGATIKSMDEYEKQYKIAADDPQKYWANVASQ
YHWFKKWDTVLEWNEPFSKWFVGGETNLCYNALDVHINTWRKNKAAIIWEGEPGDQRTLT
YLQLHREVSKFANVLKRRGIQKGDRVAIYMGMTPELVIAVLACARIGAVHNVIFAGFSAH
ALTERINDSHAKMIVCADGTIRRGKSLNLKEVVDEALVDTPSIQNVIVYQRTKETIHMQD
GRDHWWHDLMGLASEYCPAESLDSEHPLFILYTSGSTGKPKGILHSTGGYMTHVANSFKH
VFDVKEQDIYWCTADIGWITGHSYMIYGPLINGSTIVVYEGAPNYPQWDRFWDIIQRHKV
TIFYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPINPEAWMWYYKNVGKEKCPIVD
TWWQTETGGIMISPLPGATPLKPGTATRPLPGILVDVVHKDGTPCQANEGGFLVVKHPWP
SMLRTIYGDEERYKTTYWSEVDGMYFTGDGARKDNDGYIWIMGRVDDVVNISGHRLGTSE
VESALVSHEAVAEAAVVSRPDEVKGNALVAFVTLKEEFEGNQKLREELRAHVAKEIGPIA
KPDDVRWAAALPKTRSGKIMRRLLREMASSKEVKGDVTTLEDFTVLEKLREEEEESKKD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaacactgaatcaaacgcaggaatcagctctgttttgcacgagcagcgagtc
ttcaagcctggccctgagttttcagagggcgcaacgattaaatcgatggacgagtacgaa
aagcagtacaaaatcgccgctgatgatcctcaaaaatactgggcaaatgtggcctctcag
taccactggttcaaaaagtgggataccgttcttgagtggaacgagcctttttctaaatgg
tttgtaggtggcgagacgaacttatgctacaacgctctggacgtgcacatcaacacctgg
cggaaaaacaaagccgcgatcatttgggaaggtgaaccgggcgaccagcgcaccctgact
tatttgcagcttcatcgcgaagtgagcaaatttgccaacgtgctcaaacgccgcggcata
caaaaaggcgaccgtgtagcaatttacatgggcatgacccccgaactcgttatcgccgtt
cttgcctgtgcccgtattggcgcggttcacaacgtgatatttgccggcttctctgctcat
gcgctcaccgaacgcatcaacgactctcatgctaaaatgattgtttgtgcagatggcacg
attcgccgcggcaaaagcctcaacctcaaagaagtggttgatgaagcattagtcgataca
ccatccattcaaaacgtgattgtttatcagcgcacaaaagaaacgattcacatgcaagat
ggccgcgaccactggtggcacgacctcatgggactcgcttctgaatactgccctgctgag
tcactcgattccgaacatccactttttatcctttacaccagcggttctaccggaaagccg
aaaggtattcttcactccactggcggctatatgactcatgttgccaactccttcaagcac
gtttttgatgttaaagagcaagatatttattggtgcactgccgatattggttggattacc
ggccatagctacatgatctatgggccgctcatcaacggctcaaccatcgtggtctacgaa
ggcgcaccaaactacccgcaatgggatagattctgggacatcatccaacgccacaaagtc
accattttctacacagcgccaaccgctattcgtgccttcattcgcgctggagatgaatgg
gttaccaagcatgatctctcttcgcttcgcctgctcggcaccgttggagaaccgattaac
ccagaagcctggatgtggtactataaaaacgtgggcaaagaaaaatgccctatcgttgat
acttggtggcaaactgaaaccggcggcattatgatttctccgcttcctggtgccacgcca
ttgaaaccgggcactgccacgcgtccgcttcctggcattttagttgatgttgttcataaa
gatggcacgccttgccaagccaatgaaggtggatttttggtggtgaaacatccttggcca
tccatgcttcgcaccatttatggcgatgaagagcgctacaaaaccacttactggtcggaa
gtcgacggcatgtacttcactggcgacggtgcaagaaaagacaatgacggatacatttgg
atcatgggacgcgttgatgacgtggtcaatatttctggtcacagactcggcacaagtgaa
gttgaaagcgcccttgtttcgcatgaagctgttgcagaagctgctgtggtcagccgcccc
gatgaagttaaaggaaatgcgttggttgcattcgtaacgctgaaagaagagttcgaagga
aatcaaaaactccgcgaagagcttcgcgcgcatgtggccaaggaaatcggaccgattgcc
aaaccggacgatgttcgctgggctgccgcgttgccaaaaacacgcagcggaaaaatcatg
cgtcgcttgcttcgtgaaatggcctcaagcaaagaagttaagggcgacgttactacgctt
gaagactttaccgtgctcgaaaaacttcgcgaagaagaagaagagagcaaaaaggactaa

DBGET integrated database retrieval system