KEGG   Chloroherpeton thalassium: Ctha_0258Help
Entry
Ctha_0258         CDS       T00726                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cts  Chloroherpeton thalassium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ctha_0258
Enzymes [BR:cts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ctha_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
303276..303833
Genome map
AA seq 185 aa AA seqDB search
MELHSSSEHFPTKRVSSPHEIAVVTPVFIGLGTNIGNRFQNIHDAIDELRALPESQLAAI
SNLYETPPLGILDQPSFLNAVCKIDTSLEPEELLAQLKSIERRLGRPETYIKWGPRVIDL
DILFYGDLTLETAHLSIPHPEIANRKFVMVPLLDLQNPHHPILGKTIKELLAETRDSSSI
IQLCI
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaattacattcatcctcagagcactttcccaccaaaagagtttcaagtcctcatgaa
attgctgttgtaacgcctgttttcattgggcttggcacaaacatcggcaatcggtttcaa
aacattcacgacgcaatagacgagcttcgtgcgcttccagaaagccaacttgccgccatt
tcaaatctttatgaaaccccgccgcttggaattttggatcaaccgtcctttttgaatgct
gtttgcaaaatcgatacgtcgcttgaaccggaagagttgcttgctcaactaaaaagcatc
gagcgtcgacttggccgtccagaaacctacattaaatggggcccacgcgtgattgacctg
gacatcttattttatggcgatttgactttagagaccgctcacctgagcattccacatcct
gaaatcgccaatcggaagtttgtgatggtgccacttttagatcttcaaaatccgcaccat
ccgattttgggcaaaacgatcaaagagttgcttgcagaaacccgcgatagttcgagcatt
atccaactttgcatctga

DBGET integrated database retrieval system