KEGG   Chloroherpeton thalassium: Ctha_0457Help
Entry
Ctha_0457         CDS       T00726                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cts  Chloroherpeton thalassium
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ctha_0457
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ctha_0457
   00650 Butanoate metabolism
    Ctha_0457
  Energy metabolism
   00190 Oxidative phosphorylation
    Ctha_0457
   00720 Carbon fixation pathways in prokaryotes
    Ctha_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(536851..537369)
Genome map
AA seq 172 aa AA seqDB search
MEKRAAKQSGAFGWFFQRISGMLLLATLIGHFWVQHMPTDALSNPEEYRAIRQAYMEKYP
EYKAAVEHGKISEARAGEHLITYEKVTTRLSNPIWKIFDLLFLIFGLYHGMNGLLNIIDD
YVRHTGLRLTLVSFCWVLAALLLVQGGLTVITAGVYQPPLGLENILSGLALK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagagcggcaaaacaaagcggcgcattcgggtggttttttcagcgcatttcc
ggcatgttgcttttagcaactttaatcggtcacttttgggtgcaacacatgccaacagac
gcgctttcgaatcctgaagaatatcgcgctattcgccaagcttacatggaaaaatatcca
gaatacaaagcggctgtcgaacacggaaaaatttccgaagctcgcgccggcgaacatctc
attacctacgaaaaagtgaccacacggctttccaatcccatttggaaaatctttgatctg
ttgtttctcatctttggattgtatcacggcatgaacggccttttgaacatcatcgatgat
tatgttcgacacacgggattgcgccttacgctcgtttctttttgttgggtgttggcggcg
ctgctgctcgtgcaaggcggactaaccgtaatcacagccggggtttatcagccaccactt
ggccttgaaaatattctcagcgggctggctttaaaataa

DBGET integrated database retrieval system