KEGG   Chloroherpeton thalassium: Ctha_0487Help
Entry
Ctha_0487         CDS       T00726                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cts  Chloroherpeton thalassium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ctha_0487
Enzymes [BR:cts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ctha_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
569411..570124
Genome map
AA seq 237 aa AA seqDB search
MKHAEKSLTDARNGHRTATSFIDAVTEEIGDEHISTSVDTPIRPDAFDQDDELKMELIAE
HFEKIMLILGLDLKDDSLRGTPKRVAKMYVKEIFSGLNPANKPKVALFDNSYKYNEMLIE
KDIIVHSTCEHHFVPILGKAHVGYISSGKVIGLSKINRIVQYYAKRPQVQERMTMQIVKE
LKETLQTEDVAVVIDARHLCVSVRGVEDVASSTVTSSYNGKFLNEQTRNEFLKHIYG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgctgaaaaatcccttaccgatgcccgtaacggacatagaaccgcaacctca
tttatagacgccgtgactgaggaaattggcgatgaacatatcagcacgtcggtggataca
ccgattcgtcctgatgcgtttgatcaggacgatgaactcaaaatggagctaattgccgag
cactttgaaaaaatcatgctgattttaggccttgacctaaaagacgacagcttgcgcggc
acaccgaagcgcgtggcaaaaatgtatgtcaaagaaattttcagcggactcaatcccgcc
aataaacccaaagtcgcgttgttcgacaattcttacaagtacaatgaaatgctcattgaa
aaagacatcattgtgcattctacttgtgagcatcattttgttcctattctcggcaaggcg
catgtcggatacatttcaagcggcaaggtgattggtctttcaaaaattaaccggatcgtg
cagtattacgccaaacgcccgcaagttcaagagcgaatgaccatgcaaattgtcaaagaa
ctaaaggaaaccttgcaaactgaggatgtggctgtggttattgatgcgcggcatttgtgc
gtatcggttcgcggggttgaagatgtggccagctcaactgtgacttccagctacaatggc
aagtttttgaacgaacagacccgcaacgaatttctgaaacatatctacggatga

DBGET integrated database retrieval system