KEGG   Chloroherpeton thalassium: Ctha_0537Help
Entry
Ctha_0537         CDS       T00726                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ctha_0537 (tpiA)
   01230 Biosynthesis of amino acids
    Ctha_0537 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_0537 (tpiA)
   00051 Fructose and mannose metabolism
    Ctha_0537 (tpiA)
   00562 Inositol phosphate metabolism
    Ctha_0537 (tpiA)
Enzymes [BR:cts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ctha_0537 (tpiA)
Exosome [BR:cts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ctha_0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ctha_0537 (tpiA)
  Exosomal proteins of melanoma cells
   Ctha_0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(636164..636922)
Genome map
AA seq 252 aa AA seqDB search
MRKKFVAGNWKMNKDLLGAVSLATEILQLLGDEAPTCEVAIAPTFLCQQAVFQVIDESAI
KLAAQNCFYEDQGAYTGEISAAMLRNSGCEYVILGHSERRQYFNETDEIVNKKVKNALSV
ELDVIMCVGETLEQRESGVTKSVVETQVRGGLKDLTAEDMKSVVIAYEPVWAIGTGKTAT
PEQAQEVHAFIRGIVKDMFGEEVANELRIQYGGSVKTSNAKELFGMPDIDGGLIGGASLN
AEDFVEIIKSAE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaagtttgttgccggaaactggaaaatgaataaggatttgcttggagcagtt
tccttagccacagagattctacaacttcttggtgatgaagcgcctacctgtgaagtggcc
attgcgccaacttttttatgtcaacaagcggtttttcaggtgattgatgagtccgcaatt
aagcttgccgcgcaaaattgcttttatgaagatcaaggcgcatacacgggcgaaatttca
gcagccatgctcagaaattccggctgcgagtatgtcatcttgggacactcggagcgtcgg
caatattttaatgagacggatgaaatcgtcaataaaaaagtcaaaaatgcactttcagtt
gagttggacgtgattatgtgtgttggcgaaacgctcgagcaacgcgaaagcggcgtgaca
aaatcggtggtagaaacgcaagttcgcggcggtttaaaagatctcacggctgaggatatg
aaaagcgttgtcatcgcttatgagccggtttgggcaattggcacaggtaaaaccgcaaca
cccgagcaagcgcaggaagtacatgcgtttatccgcggaatcgtcaaggatatgttcggt
gaagaagttgccaatgagcttcgcattcaatatggcggaagcgtgaaaacaagcaatgcc
aaagagcttttcggtatgccggatattgatggtggtctaattggtggcgcgagcttaaac
gcggaagattttgtagaaattatcaagtctgcagaataa

DBGET integrated database retrieval system