KEGG   Chloroherpeton thalassium: Ctha_0777Help
Entry
Ctha_0777         CDS       T00726                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cts01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cts00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cts00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cts00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cts00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cts00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
924761..925723
Genome map
AA seq 320 aa AA seqDB search
MEKVALGIDLGGTAIKFAAVTETGNIIATHHAPTEAEHGLEHVIENMMRGIAELIAQTKS
VELSGIGIGVPGVVSLDGGTVSHPPNLPGWEVVRLGDAIAEKFRQVYGATKPVFVENDAN
LAALGEARFGAGTALNDFIMITLGTGIGAGIIINRKIFRGTTGAAGEFGHIPIDYNSETA
HAGIHGSVEGFIGQRHIAEYARKLAKNHPDSLLHQLCPDLSQLEPKHITAAAEQGDPLAL
AIWQWVAEILGAGLGAIVSILDIRKFVIGGGVAGAGKYLFEPCLGALKRFTLSSMHEGIE
LLPAKLGNQAGVMGAAAQAL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgcactcggcatagaccttggcgggacagctatcaagtttgccgccgtc
accgaaaccggaaacatcatcgccacgcatcacgcgccaacagaagccgaacatggcctt
gagcatgttatagaaaacatgatgcgcggcattgccgaactgatcgctcaaaccaaatcg
gtagaactttcgggaattggcatcggcgtgccaggcgtcgtcagcttggatggcggcacg
gtgagtcatccgccgaacttgccgggttgggaagtcgttcgtctcggcgatgctattgct
gaaaaatttcgtcaggtttatggcgcaacaaagcccgtttttgtggaaaacgacgccaac
cttgcggcgctcggcgaagcgcgtttcggcgcgggcactgcgctaaacgattttatcatg
atcacgcttggcacgggaattggcgcggggattatcattaaccgaaaaatttttcgcggc
acaacgggtgctgcaggcgaattcggtcacatcccgattgattacaacagtgaaactgcg
cacgcgggcattcacggttcggtggagggtttcatcgggcaacggcacattgcggagtat
gcgcgcaaactggcgaaaaatcatcccgactcgcttctgcatcagctttgccccgatctc
tcacaacttgagccgaagcatattacagcggctgcagaacaaggcgacccgctcgcgttg
gctatttggcaatgggttgccgaaattttgggcgcgggacttggcgcgattgtctctatc
ttggacattcgcaaattcgtgattggcggcggcgtggcgggcgcgggcaaatatttgttt
gaaccttgccttggcgcactgaagcgattcacgctgagctccatgcacgaaggaattgaa
cttttaccggccaagcttggcaatcaagctggcgtaatgggcgcggcggcgcaggctttg
taa

DBGET integrated database retrieval system