KEGG   Chloroherpeton thalassium: Ctha_0784Help
Entry
Ctha_0784         CDS       T00726                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_0784
Enzymes [BR:cts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Ctha_0784
Exosome [BR:cts04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ctha_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(932081..933274)
Genome map
AA seq 397 aa AA seqDB search
MKKKTVDDVSFAGKRVLMRVDFNVPLKDGAVTDDIRIRGALPSIQKVLSDGGCVILMSHL
GRPKGKPVAEMSLKPAADRLAELLGKPVQMAPDCIGDEVKNMAAAMKAGDVLMLENLRFH
KEEEANDPEFAKSLASLGEVFVNDAFGTAHRAHASTEGVTNYVAESVAGYLIGKELTYLG
EATANPVRPFVAILGGAKISGKIDVLENLLGKVDTVLVGGAMVFTFFKAQGYNIGKSLVE
DDKLELAKSILEKAKTSGVKFLLPTDVVLADKFDQDANTKIATIDSIEDDWMGLDIGPET
ANCFREEVVNAKTVIWNGPMGVFEMEKFAKGTMAVAQALADATKQGAITVIGGGDSAAAI
AVAGLEDSVTHVSTGGGASLEFLEGKELPGIAALSNA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaaccgttgatgacgtctcctttgctggaaaacgcgtgctgatgcgcgtt
gattttaatgtgccgcttaaagacggcgcagtcaccgacgatattcgcattcgtggtgca
cttccatctattcagaaagtgctgagcgatggtggatgtgtaattctcatgtcgcacctt
ggccgtccaaagggcaaaccggttgctgaaatgtcgttgaagcctgctgctgatcggctg
gctgaattgcttggaaaaccggttcaaatggcgccggattgcattggtgatgaagtcaag
aacatggctgcagccatgaaagccggtgacgtgctcatgctggaaaatcttcgtttccac
aaagaagaagaagcaaacgatcctgagtttgccaaaagcttggcatcgcttggtgaggtg
tttgtcaacgatgcgtttggaacagcacaccgcgctcatgcgtctacggaaggcgttaca
aactatgtggccgaatcggttgctggatatttgattggaaaagaattgacgtatttggga
gaagccaccgccaatccggttcgtccgtttgtcgcgattttgggtggcgcaaagatttct
ggcaaaattgatgtgctcgaaaacctgctcggaaaagtagacacggtgctggttggcggc
gcaatggttttcaccttctttaaagcacaaggctacaatattggaaaatcgttggttgaa
gacgataagttggagctggcaaaatcgattttggaaaaagcgaaaacttcaggtgtgaag
ttcttgttgccaaccgatgtggttttggccgacaaattcgatcaggatgccaataccaaa
attgcaaccatcgatagcattgaagacgattggatgggacttgatattgggccagaaacg
gccaactgcttccgtgaggaagtcgtcaatgccaagaccgttatttggaatggtccgatg
ggcgtatttgaaatggaaaaatttgcaaaaggcacaatggctgtggcgcaagctctcgcc
gatgcaacaaaacaaggtgcgattacggttatagggggtggggactccgcggctgccatt
gcagtagccggccttgaggatagcgttacgcatgtttcaaccggcggcggcgccagtctg
gaattccttgaaggaaaagaacttccaggcattgcagcgcttagcaacgcttaa

DBGET integrated database retrieval system