KEGG   Chloroherpeton thalassium: Ctha_0828Help
Entry
Ctha_0828         CDS       T00726                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cts  Chloroherpeton thalassium
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cts00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cts00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
986865..988370
Genome map
AA seq 501 aa AA seqDB search
MRLKDLINSIELVEIAGELHEDTPVGSICFDSRKVGPNAVFVAIRGFNTDGHQYINQAVE
ADAMAIVCEEIPKSWSSHQLFLKVWDSREALAKIAKRFYENASDELKVIGVTGTNGKTTT
TGMIKCILDANEIKTGLIGTTGYIIGNQLYELDRTTPDALELHQLFHKMLEAGCRAVVME
VSSHALALKRTAGIRFDIAVFTNLTHDHLDFHGSMTAYADAKKLLFDNLSESAFAVINAD
DDYAEKMVKDCKANIVRCGVINAREKELENPIIDVMAKVFSYTINGTSAIIADDKNSMMH
QFRTLGKFNMYNTVEAYAAGLAFGFDRIHIIRGLMKCPPVRGRMQQVWSKDHRCAIVDYS
HTPDALENALQTICLVKPENGRIITLFGCGGDRDKEKRPLMGKIAEDNSDIIIITSDNPR
SEDPEKILDDIQAGIHKQNNFYRIVDRETAIRKAITLLTRGDVALIAGKGHETYQEIAGK
KFHFDDKEIIESVFREQEGLI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcaaagatttgataaacagcattgaattggtagaaatagccggcgaacttcat
gaagacactcctgtgggttcaatctgtttcgactcaagaaaagtagggccgaatgctgta
tttgtcgccattcgcgggttcaacacagacgggcatcaatatatcaaccaagcggtcgag
gctgacgccatggctattgtttgtgaagaaattccaaaatcctggtcgtctcatcagctc
tttttgaaagtctgggattcgcgcgaagctttggccaaaatcgcaaagcgcttctacgaa
aacgcctccgatgagcttaaagtgattggcgtgaccggcacaaacggcaagaccacaacc
acaggaatgatcaagtgtattttggatgctaatgaaatcaaaacgggcttgatcggcaca
acgggctacattattggaaatcagctttacgaactcgatcgaaccacgcccgatgcgctc
gagctgcatcaactatttcacaaaatgcttgaggctggctgccgcgcggtggtcatggaa
gtttcatcacatgcactcgcgctgaagcgaaccgccggcattcgtttcgatattgccgtt
tttaccaatctcacacatgatcatttggattttcacggctccatgacggcctacgcagat
gccaaaaaattgctttttgataatttaagcgaaagtgcttttgccgtcatcaatgccgat
gatgattatgcagaaaaaatggtgaaagactgcaaggccaacattgtccgttgcggcgtg
attaatgcgcgggaaaaagaactcgaaaacccaatcattgatgtgatggcgaaagtcttt
agctacaccatcaatggcacatcggccatcattgccgatgacaaaaacagcatgatgcac
cagttccgcacgctcggcaagttcaacatgtacaacaccgtggaggcttacgccgccggc
ttagcattcggatttgatcgaatccacatcattcgcggcttaatgaaatgcccacctgtt
cgtggcagaatgcagcaggtttggtcgaaggatcatcgctgcgccattgtggattattcg
cacacaccggatgcgttggaaaacgcgctgcaaaccatctgccttgtgaaaccggaaaac
ggaagaattattaccctatttggctgcggcggcgatcgcgacaaagaaaaacgtcccctt
atgggaaaaattgcggaagacaattcggacatcatcatcatcacatccgacaatcctcgt
tccgaagatcctgaaaaaattttggacgacattcaagccggcattcacaaacagaacaac
ttttaccgaatcgtcgatcgcgaaacggccattcgcaaagccattacgcttttaacgcgc
ggcgatgttgccctgattgcaggcaaaggacacgaaacctatcaggaaattgcaggaaag
aaatttcattttgacgataaagaaatcatagaatctgtttttagagaacaagaagggttg
atttag

DBGET integrated database retrieval system