KEGG   Chloroherpeton thalassium: Ctha_1214Help
Entry
Ctha_1214         CDS       T00726                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cts01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cts00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cts00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1428491..1429732
Genome map
AA seq 413 aa AA seqDB search
MNEKESIISDAEQRNQPYSAPDARGYFGNYGGKFIPETLIKNAAELEAEYLECRNDPAFW
QEYRDLLKNYVGRPTPLYYAKRLSQELGGAKIYLKREDLCHTGAHKINNAIGQVLLAKRM
GKTRIIAETGAGQHGVATATVCALMGLNCFVFMGEEDIERQAPNVARMKLLGATVMPVSS
GSRTLKDATSEAIRDWVTNPEDTFYIVGSVIAMHPYPMMVRDFQSVIGTETRSQILEAEG
RLPEKIVACVGGGSNAMGMFYPFLNDVPEVKLIGVEAAGEGLDKLHAASLTCGKRGVLHG
AMMRVLQNADGQIELAHSISAGLDYPGVGPEHCHLQEIGLASYESATDTEALQALKTLAR
TEGIICALESAHAMHFAITEAPKMKPSEILVLNLSGRGDKDLNTIMKHFANEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaagaatcaattatttctgatgccgagcagcgcaatcagccatacagcgca
cctgatgcgcgaggctattttggaaattacggcgggaagttcattcctgaaacgctgatt
aaaaacgccgccgaactggaggctgaatatttagagtgtaggaacgatccggcgttttgg
caagaatatcgggatttgttgaagaattatgtcggtcgaccaacgccgctgtattatgca
aagcggctcagccaagaacttggcggcgcaaagatttatttaaagcgtgaggatttgtgc
cacacaggcgcacataaaattaataacgcgattggccaagtgctgctcgccaaacgaatg
ggaaaaacgcgcatcattgccgaaaccggcgccggccagcacggcgtggcaaccgcaacg
gtttgcgccctcatgggactcaattgcttcgtcttcatgggcgaagaagatattgagcgc
caagcgccgaatgtcgctcgaatgaaattgctcggtgccacggtgatgccggtcagttcg
ggcagtcgcacgctcaaagatgccaccagcgaggcgattcgcgactgggtcaccaacccg
gaagacacattctatattgtcggttcggtgatcgcaatgcacccatatccgatgatggtt
cgcgattttcaaagtgtgataggcacggaaacgcgctcgcaaattcttgaagcggaaggc
cgtctgccggaaaaaattgtggcgtgcgtgggcggcggcagcaacgcgatgggcatgttt
tatccgttcctaaacgatgtgccggaagtaaagcttatcggcgtggaagcggcgggcgaa
ggtttggataaacttcatgcggcgtcgctcacctgcggcaaacgcggcgtccttcatggg
gcgatgatgcgcgtcttgcaaaacgctgatgggcaaatcgaactggcgcactccatttcc
gccggtttggattatccgggcgttgggcctgagcattgccatcttcaggaaatcggcctc
gcaagctacgaatccgccaccgacacagaggcgcttcaagccctgaaaacacttgctcgc
accgaaggcatcatctgcgccttggaaagcgcccatgccatgcacttcgccatcaccgaa
gcgccgaaaatgaagccaagcgaaatcttggttttaaatctttcgggcagaggtgataaa
gatctgaacacaatcatgaagcactttgccaatgagttgtag

DBGET integrated database retrieval system