KEGG   Chloroherpeton thalassium: Ctha_1214Help
Entry
Ctha_1214         CDS       T00726                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00260  Glycine, serine and threonine metabolism
cts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01130  Biosynthesis of antibiotics
cts01230  Biosynthesis of amino acids
Module
cts_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ctha_1214
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ctha_1214
Enzymes [BR:cts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ctha_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACF13678
JGI: Ctha1214
UniProt: B3QYY5
Position
1428491..1429732
Genome map
AA seq 413 aa AA seqDB search
MNEKESIISDAEQRNQPYSAPDARGYFGNYGGKFIPETLIKNAAELEAEYLECRNDPAFW
QEYRDLLKNYVGRPTPLYYAKRLSQELGGAKIYLKREDLCHTGAHKINNAIGQVLLAKRM
GKTRIIAETGAGQHGVATATVCALMGLNCFVFMGEEDIERQAPNVARMKLLGATVMPVSS
GSRTLKDATSEAIRDWVTNPEDTFYIVGSVIAMHPYPMMVRDFQSVIGTETRSQILEAEG
RLPEKIVACVGGGSNAMGMFYPFLNDVPEVKLIGVEAAGEGLDKLHAASLTCGKRGVLHG
AMMRVLQNADGQIELAHSISAGLDYPGVGPEHCHLQEIGLASYESATDTEALQALKTLAR
TEGIICALESAHAMHFAITEAPKMKPSEILVLNLSGRGDKDLNTIMKHFANEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaagaatcaattatttctgatgccgagcagcgcaatcagccatacagcgca
cctgatgcgcgaggctattttggaaattacggcgggaagttcattcctgaaacgctgatt
aaaaacgccgccgaactggaggctgaatatttagagtgtaggaacgatccggcgttttgg
caagaatatcgggatttgttgaagaattatgtcggtcgaccaacgccgctgtattatgca
aagcggctcagccaagaacttggcggcgcaaagatttatttaaagcgtgaggatttgtgc
cacacaggcgcacataaaattaataacgcgattggccaagtgctgctcgccaaacgaatg
ggaaaaacgcgcatcattgccgaaaccggcgccggccagcacggcgtggcaaccgcaacg
gtttgcgccctcatgggactcaattgcttcgtcttcatgggcgaagaagatattgagcgc
caagcgccgaatgtcgctcgaatgaaattgctcggtgccacggtgatgccggtcagttcg
ggcagtcgcacgctcaaagatgccaccagcgaggcgattcgcgactgggtcaccaacccg
gaagacacattctatattgtcggttcggtgatcgcaatgcacccatatccgatgatggtt
cgcgattttcaaagtgtgataggcacggaaacgcgctcgcaaattcttgaagcggaaggc
cgtctgccggaaaaaattgtggcgtgcgtgggcggcggcagcaacgcgatgggcatgttt
tatccgttcctaaacgatgtgccggaagtaaagcttatcggcgtggaagcggcgggcgaa
ggtttggataaacttcatgcggcgtcgctcacctgcggcaaacgcggcgtccttcatggg
gcgatgatgcgcgtcttgcaaaacgctgatgggcaaatcgaactggcgcactccatttcc
gccggtttggattatccgggcgttgggcctgagcattgccatcttcaggaaatcggcctc
gcaagctacgaatccgccaccgacacagaggcgcttcaagccctgaaaacacttgctcgc
accgaaggcatcatctgcgccttggaaagcgcccatgccatgcacttcgccatcaccgaa
gcgccgaaaatgaagccaagcgaaatcttggttttaaatctttcgggcagaggtgataaa
gatctgaacacaatcatgaagcactttgccaatgagttgtag

DBGET integrated database retrieval system