KEGG   Chloroherpeton thalassium: Ctha_1287Help
Entry
Ctha_1287         CDS       T00726                                 

Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ctha_1287
Enzymes [BR:cts01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ctha_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1506885..1510694)
Genome map
AA seq 1269 aa AA seqDB search
MSEKKKIVAILGMDQYNRRVWKDVRQMLGDAAELTEWSDLDLEQQNEELATALQSADCLF
LTLIQFKPQADWLKECLEKSSVETIFAYESMPEVMAMTKVGDYNPAGDGSGMPDIVKKVA
KMLVKGRDEDALYGYMKLLKIMRTMLPLIPNKAKDFKHWMQVYSYWLHPTGENLANMFRL
ILREYFGANLKVESVVEVPTMGFYHPEAPDYFKDASHYNKWQKKRSNDPKNSSRVGLLFF
RKHLLQERAYIDAAILELEKAGLYVLPVFVMGVEGHVAVREWFPKENIDLLINMMGFGLI
GGPAGSTTPGTSAEARDEIFSKIDVPYIVAQPLFIQDMDSWRLHGVTPLQSAMLYSMPEM
DGAISPVVLGAGKDGRITPTKDRMQRLAQIAVRWTSLRKKPNSEKKLGFVVYDYPPGLGR
KSSAALLDVPKSLLAMLHRLKSEGYHVGDIPETADELYNMLDKATDFQTQFNAPDAICVT
HDEFRNMTTEGEREKINARWDSFPGDIAPAAEDKVYIGGLTFGNIYIGVQPRLGIQGDPM
RLLFDKENTPHHQYISFYRWLSRKFMADGIIHVGMHGTAEWMPGLQLGLTQDCWPDALLG
EVPQVYIYPVNNPSEANIAKRRGYATMISHAVPPLSRAGLYKELPALKDMIADYRERGLD
KSDDAEIQEAVLEKVAQLNLSDDCPYKEGEPFQDYVSRLYVYLMDLENRLISSEMHVFGK
STPVEEQVTTITEMLKLRGENLSLPSIILSTYPEGKKYSGYAELASLARKGDKNAIALRE
KIDQACKEFVEQCIFANNDPRSVFGKLTSGASISEEMAKSLNEGLRAGRETVEGMKDNSG
EMDALVRVLNGRYLPAGPGGDLIRDGANILPTGRNIHSIDPWRIPSEVANSRGAQIAESI
IERHLAENDHEFPETVAQVLWGLDTIKTKGESIGIVIRLMGARPGYDAQGKISHYELIPL
SELGRPRIDVLMQVSSIFRDNFGNLMNLLDRLVKDAAKADEPHDMNFIKKHVDEALAEGK
SFESATSRIFTQAQGMYGSSIDEMVEDSAWESEEDLDSVFVRRTSYAYGGNRNGALETDV
LKGLLGTVDRVVQQVDSAEFGVSDIDRYFSSSGSLQLSARLHNKKGKTVKLNYVESFTAD
VKVDDVEKTLRVEYRSKLLNPKWYENMLAQGHSGATEISNRFTYMLGWDAVSKSVDDWVY
KEAAETYAFDPNIRERLAKANPEAMKNIVGRMLEASGRGMWQADQDTIDKLQEIYADLED
RLEGIEHAM
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagaaaaaaattgtagccattttaggcatggatcagtacaaccgtagggtt
tggaaagatgtccgtcaaatgctcggcgacgccgccgaactgacggaatggtccgacctt
gacctcgaacaacaaaatgaggaacttgcaacggcgcttcaatcagccgattgccttttt
ctgacgctgattcagttcaagcctcaggcagactggctcaaagaatgcctcgagaaatcg
tcggtcgaaaccatctttgcctacgaatcgatgccagaagtgatggccatgacaaaagtc
ggcgattacaacccagccggcgacggcagcggtatgcccgacatcgtcaagaaggttgcc
aagatgcttgttaaaggacgcgatgaagatgcgctgtatggctacatgaagttgctaaaa
atcatgcgtaccatgttgcctttgattccgaacaaggcaaaagatttcaagcattggatg
caggtctactcttactggcttcatccgacgggtgaaaacctcgccaacatgttccgctta
attttgcgtgaatattttggcgcaaacctcaaagtggaatcggtggttgaagtcccaact
atgggcttttatcatcctgaagcgccagactatttcaaagatgcaagccattacaacaaa
tggcagaagaaaagatcaaacgatccgaaaaattcttctcgcgtcggattgcttttcttc
cgcaaacacttgcttcaagagcgcgcctacatcgatgctgccattttggaattggaaaaa
gccgggctttatgttttgccggtgttcgtcatgggtgtggaagggcatgtcgccgttcgc
gaatggttcccgaaagagaacatcgacttgctcattaacatgatgggcttcggcttaatc
ggcggccctgctggttcaaccacgccgggcacttccgcagaagctcgcgatgaaatcttc
tcgaaaattgacgtgccgtacattgtggcacagccgcttttcatccaagatatggattct
tggcgtttgcacggtgtcacaccgctccagtccgccatgctttattccatgccggaaatg
gacggcgcaatttctccggtggtgcttggcgccggtaaagacgggcgcatcacaccgacc
aaagaccgtatgcagcgtttggcgcaaatcgcggttcgctggacatcgcttcgcaaaaag
ccgaacagcgaaaagaaactcggctttgtcgtttatgactatcctcctggcttgggcaga
aaatcaagcgcggcgctgctcgatgtgccgaaaagcttgcttgccatgcttcatcgcctg
aaatcggaaggctatcatgtcggcgacattcccgaaactgctgacgagctttataacatg
ttggataaagcaaccgatttccaaacgcagttcaacgcgccggatgccatttgcgtgacc
cacgatgaattccgcaacatgacgacggaaggcgagcgcgaaaaaatcaacgcgcgttgg
gattccttcccgggcgacatcgcgccggctgctgaggacaaagtctacatcggcggcttg
actttcggaaatatctatatcggtgtgcaaccgcgtctcggcattcaaggcgacccgatg
cgcctgttgtttgacaaagaaaacacaccgcaccatcaatatatctcgttctatcgctgg
ctcagccgcaagtttatggccgacggcatcatccatgtcggtatgcacggcacagcggaa
tggatgccaggtttgcagctcggcttaacgcaagattgctggccggatgcgctgctcggc
gaagtcccacaggtttatatttatccggtcaataacccgagcgaggcgaacatcgccaag
cgtcgcggctatgcaaccatgatttcgcacgccgtgccgccgctttcacgcgctggactt
tacaaagaattgcccgcgctcaaagacatgatcgccgattatcgcgaacgcggtttggac
aaatccgacgatgcagaaatccaggaagccgttttggaaaaagtcgcccaactcaatctt
tccgacgattgcccatataaagaaggcgagccgttccaagattatgtcagccgactttat
gtctatttgatggatttggaaaatcgtttgattagcagcgaaatgcacgtgttcggcaaa
tccacgccggttgaagagcaggtcacgacgattaccgaaatgctcaagcttcgtggcgaa
aatctctcgttgccgtccatcattttaagtacttatcccgaaggcaaaaaatatagcggc
tatgctgaattggcatcgcttgcgcgtaagggcgacaaaaacgcgatcgctctccgcgaa
aaaattgatcaagcctgcaaagaatttgttgagcagtgcattttcgccaacaacgatccg
cgtagcgtctttggcaaattgacaagcggcgcaagcatttccgaagagatggccaaatcg
ctgaacgaaggcctccgagccggacgcgaaacggttgaaggcatgaaagacaattcgggt
gaaatggacgcgctcgttcgtgtgttgaacggtcgttatttgccggcaggcccgggcggc
gacctcatccgcgacggggcaaacattttgccgaccggtcgcaacattcactcgattgac
ccgtggcgcattccgtcggaagtcgccaactcgcgcggtgcgcaaatcgccgagtccatc
atcgagcgccacttggccgaaaacgaccacgagtttcccgaaaccgtcgcacaggttttg
tggggtctcgacaccatcaaaaccaaaggggaatctatcggtatcgtcattcgcttgatg
ggtgcaagaccgggctacgatgcgcaaggcaaaatcagccattacgaactcattccgctt
tcggaacttggccgcccgcgtatcgatgtgctcatgcaggttagctcgattttccgcgac
aacttcggcaacctgatgaacctcttagaccgcttggtcaaagacgccgccaaagccgac
gaaccgcatgacatgaacttcatcaaaaaacacgtggatgaagcgcttgccgaaggcaaa
tcgtttgaaagcgcgacctcgcgtatcttcacgcaggcgcaaggcatgtatggcagctcg
attgacgaaatggttgaagattccgcgtgggaatctgaggaagacttggacagcgttttc
gttcgccgcaccagctatgcgtatggcggaaaccgcaacggtgcgcttgaaaccgacgtg
ctcaaaggcttgctcggcacggttgaccgtgttgtccaacaggttgactcggcggagttc
ggcgtttccgacatcgaccgctacttctcgtcgtcgggatcgttgcagctttcggctcgc
ttgcacaacaagaagggcaaaacggtaaagctcaactatgtggaatccttcaccgccgac
gtgaaagtcgacgatgtggaaaaaacgctgcgtgtggaatatcgttccaaattgctcaat
ccgaagtggtacgaaaacatgctggcgcaaggccacagcggcgcaacggaaattagcaac
cgcttcacctacatgctcggttgggacgccgttagcaagagcgttgacgattgggtatat
aaagaagcggctgaaacctacgcgtttgacccaaacattcgcgagcgacttgcaaaagcc
aatccagaagcgatgaaaaacatcgtaggccgaatgctcgaagccagcggacgcggcatg
tggcaagccgaccaagacaccatcgataagcttcaagaaatctacgctgaccttgaagat
cgtctcgaaggcatcgaacacgccatgtaa

DBGET integrated database retrieval system