KEGG   Chloroherpeton thalassium: Ctha_1339Help
Entry
Ctha_1339         CDS       T00726                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cts  Chloroherpeton thalassium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ctha_1339
Enzymes [BR:cts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ctha_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1568078..1569010
Genome map
AA seq 310 aa AA seqDB search
MNMLRRDDELQIKENFIFKFHGHRLDFLERPQIMGILNITPDSFSDGGRFVKNGMSQIDV
DKAVLEAEQMVQDGADIIDIGGESTRPGSEEVSVAEEIRRTASVIDALARKIHVPISIDT
WKSEVAEAALKAGATIVNDISGFHFDENLAPLCARYQVPAILMHIRQKPHDMSWSFNDTT
TYRELVAEVKAFLADSLKLAEAHGVTQTILDVGFGFGKNVQGNFELLASLAEFKSFERPL
LAGLSRKSFIGQALQNEKNEHVPTHARLFGTVAANTIALMNGANVLRVHDVKAAADAMKI
VRATKLAQAK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcttcgacgcgacgacgaacttcagataaaagagaatttcatttttaaattt
cacggccatcgattggattttcttgagcgacctcaaattatggggattttgaacatcacg
cccgattcgtttagcgacggcgggcgatttgtgaaaaatggcatgtcgcaaatcgacgtc
gacaaagccgtgctggaggctgaacaaatggttcaggatggcgcggacatcatcgacatt
ggcggcgagtccacgcggccaggctccgaggaagtctcggtagctgaagaaatccgccga
actgcgtccgtgattgacgcgttggctcgcaaaattcacgtgccgatttcgattgacacg
tggaaatccgaggttgcggaagcggcgctcaaggccggcgcaaccatcgtgaatgacatt
tccggctttcattttgacgaaaatcttgcgccgctttgtgctcgttatcaagtgccggct
attttgatgcacattcgccaaaagccgcacgacatgagctggagcttcaacgacaccaca
acctaccgtgagcttgtcgctgaagtcaaagcgtttttggccgattcgctcaaactggct
gaagcgcatggcgtcacgcaaaccattttggatgtcggatttgggtttgggaaaaatgtt
cagggaaattttgaattgcttgcgtcgttagccgaattcaaatcatttgaaaggccgctg
cttgccggactttcgcgtaaatcgtttatcggacaggcgcttcaaaatgaaaaaaatgaa
cacgtgccgacccatgcgcggctttttggcacggtggctgcaaacaccatcgccttgatg
aacggcgcaaatgtgctgcgcgtgcatgatgtgaaagccgccgccgacgcgatgaaaatt
gtgcgagcaaccaagctggcacaggcaaagtaa

DBGET integrated database retrieval system