KEGG   Chloroherpeton thalassium: Ctha_1339Help
Entry
Ctha_1339         CDS       T00726                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cts  Chloroherpeton thalassium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cts00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1568078..1569010
Genome map
AA seq 310 aa AA seqDB search
MNMLRRDDELQIKENFIFKFHGHRLDFLERPQIMGILNITPDSFSDGGRFVKNGMSQIDV
DKAVLEAEQMVQDGADIIDIGGESTRPGSEEVSVAEEIRRTASVIDALARKIHVPISIDT
WKSEVAEAALKAGATIVNDISGFHFDENLAPLCARYQVPAILMHIRQKPHDMSWSFNDTT
TYRELVAEVKAFLADSLKLAEAHGVTQTILDVGFGFGKNVQGNFELLASLAEFKSFERPL
LAGLSRKSFIGQALQNEKNEHVPTHARLFGTVAANTIALMNGANVLRVHDVKAAADAMKI
VRATKLAQAK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcttcgacgcgacgacgaacttcagataaaagagaatttcatttttaaattt
cacggccatcgattggattttcttgagcgacctcaaattatggggattttgaacatcacg
cccgattcgtttagcgacggcgggcgatttgtgaaaaatggcatgtcgcaaatcgacgtc
gacaaagccgtgctggaggctgaacaaatggttcaggatggcgcggacatcatcgacatt
ggcggcgagtccacgcggccaggctccgaggaagtctcggtagctgaagaaatccgccga
actgcgtccgtgattgacgcgttggctcgcaaaattcacgtgccgatttcgattgacacg
tggaaatccgaggttgcggaagcggcgctcaaggccggcgcaaccatcgtgaatgacatt
tccggctttcattttgacgaaaatcttgcgccgctttgtgctcgttatcaagtgccggct
attttgatgcacattcgccaaaagccgcacgacatgagctggagcttcaacgacaccaca
acctaccgtgagcttgtcgctgaagtcaaagcgtttttggccgattcgctcaaactggct
gaagcgcatggcgtcacgcaaaccattttggatgtcggatttgggtttgggaaaaatgtt
cagggaaattttgaattgcttgcgtcgttagccgaattcaaatcatttgaaaggccgctg
cttgccggactttcgcgtaaatcgtttatcggacaggcgcttcaaaatgaaaaaaatgaa
cacgtgccgacccatgcgcggctttttggcacggtggctgcaaacaccatcgccttgatg
aacggcgcaaatgtgctgcgcgtgcatgatgtgaaagccgccgccgacgcgatgaaaatt
gtgcgagcaaccaagctggcacaggcaaagtaa

DBGET integrated database retrieval system