KEGG   Chloroherpeton thalassium: Ctha_1366Help
Entry
Ctha_1366         CDS       T00726                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cts  Chloroherpeton thalassium
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cts01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cts00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1598697..1599479
Genome map
AA seq 260 aa AA seqDB search
MTYLDKILEHKRKEIEALKPQNFKKQFESQAENLPAPRDFAAALRRKAPSEPLRLIAELK
KASPSRGVMVHDFKPLEIAERYRTLGASAYSVLTDEEFFQGHANYLKAVRENFDLPVLRK
DFIIDESQIYEARLLGADALLLIVAALSPEALLQFRELAESLGMSALVEVHSKPELDIAV
ACGATIIGVNNRDLRTFKVNIQTSVELFASYPNDVIAVSESGIKTPEDLQQLADAGFDAV
LIGEGLITSERLAAYGWNEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacctatttagataaaattcttgagcataaacgaaaagaaattgaggcgttgaagccg
caaaatttcaaaaagcaatttgaatcgcaggccgaaaacttgcctgctccgcgcgatttt
gcggcagcgcttcggcgaaaagcgcccagcgagccgctgcgcttgattgccgagctgaaa
aaggcatcgccatcgcgcggcgtgatggtgcatgattttaagccgcttgaaattgcagaa
cgctatcgcacgttaggcgcttcggcttattccgtcctaacggatgaagagtttttccaa
ggccatgcaaattacttaaaagccgttcgggaaaattttgacttgccggtgcttcgcaag
gattttattatcgatgaaagccagatttatgaagcgcggcttttgggtgcagacgcgctt
cttttgattgtcgcggcgctttcgcctgaagcgctgttgcagtttcgcgagcttgccgaa
tcgcttggcatgagcgcattggtggaagtgcattccaaaccggaattggacattgcggtg
gcgtgcggcgcaaccatcattggcgtcaacaaccgagatttgagaaccttcaaggttaat
attcaaacctccgttgagctttttgcaagttatcctaacgatgtgattgctgtttctgaa
agtggcatcaaaacgccagaagatttgcagcaactcgccgatgcgggatttgatgcggtg
ctcatcggcgaagggctcatcacgagcgagcgtttggccgcgtatggctggaacgaaaaa
tag

DBGET integrated database retrieval system