KEGG   Chloroherpeton thalassium: Ctha_1366Help
Entry
Ctha_1366         CDS       T00726                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01130  Biosynthesis of antibiotics
cts01230  Biosynthesis of amino acids
Module
cts_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ctha_1366
Enzymes [BR:cts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ctha_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: ACF13829
JGI: Ctha1366
UniProt: B3QZD6
Position
1598697..1599479
Genome map
AA seq 260 aa AA seqDB search
MTYLDKILEHKRKEIEALKPQNFKKQFESQAENLPAPRDFAAALRRKAPSEPLRLIAELK
KASPSRGVMVHDFKPLEIAERYRTLGASAYSVLTDEEFFQGHANYLKAVRENFDLPVLRK
DFIIDESQIYEARLLGADALLLIVAALSPEALLQFRELAESLGMSALVEVHSKPELDIAV
ACGATIIGVNNRDLRTFKVNIQTSVELFASYPNDVIAVSESGIKTPEDLQQLADAGFDAV
LIGEGLITSERLAAYGWNEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacctatttagataaaattcttgagcataaacgaaaagaaattgaggcgttgaagccg
caaaatttcaaaaagcaatttgaatcgcaggccgaaaacttgcctgctccgcgcgatttt
gcggcagcgcttcggcgaaaagcgcccagcgagccgctgcgcttgattgccgagctgaaa
aaggcatcgccatcgcgcggcgtgatggtgcatgattttaagccgcttgaaattgcagaa
cgctatcgcacgttaggcgcttcggcttattccgtcctaacggatgaagagtttttccaa
ggccatgcaaattacttaaaagccgttcgggaaaattttgacttgccggtgcttcgcaag
gattttattatcgatgaaagccagatttatgaagcgcggcttttgggtgcagacgcgctt
cttttgattgtcgcggcgctttcgcctgaagcgctgttgcagtttcgcgagcttgccgaa
tcgcttggcatgagcgcattggtggaagtgcattccaaaccggaattggacattgcggtg
gcgtgcggcgcaaccatcattggcgtcaacaaccgagatttgagaaccttcaaggttaat
attcaaacctccgttgagctttttgcaagttatcctaacgatgtgattgctgtttctgaa
agtggcatcaaaacgccagaagatttgcagcaactcgccgatgcgggatttgatgcggtg
ctcatcggcgaagggctcatcacgagcgagcgtttggccgcgtatggctggaacgaaaaa
tag

DBGET integrated database retrieval system