KEGG   Chloroherpeton thalassium: Ctha_1447Help
Entry
Ctha_1447         CDS       T00726                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cts  Chloroherpeton thalassium
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cts01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cts00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1698220..1699314
Genome map
AA seq 364 aa AA seqDB search
MSELIYKTIVVKVGTNVLSKPDGLLDEQVMSDLVSQIARMRQSGVNVILVSSGAVGAGRS
LVHLSEKTHPVETRQVLSSIGQIRLINTYAKLFNAQNLLCAQILVTKSDFRDRRHYLNMQ
TCLNALLKQGVIPIVNENDAISVTELMFTDNDELSGLIASMMQAEALLILTNVDGVFDGN
FHEGNAQVISEINSKKLDYSKYIKPVKSSFGRGGMLTKCSIAHKLSLMGITVHIANGKKS
GILEEILSGVSVGTKFISQKRTSSVKRWMAHAEGYEKGTVFINRGAEAALLSHETATSLL
PVGVLRIEGGFKKGDIIKICNEQNATLGYGMAQYDSQKAASLIGQKGQKPLVHYDYLFLK
QPEA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattgatttataaaacgattgtcgttaaagtcggcacaaatgttcttagcaaa
cctgatgggcttttagacgagcaagtcatgtcggacttggtttcgcaaatagcacggatg
cggcaaagcggggtaaatgtgattttggtttcgtcgggtgcggttggtgctgggcgctcg
ctcgttcatctttccgagaaaacgcatccggttgaaacgcgtcaggtgctttcatccatt
gggcagattcgattgattaacacctacgccaagctattcaacgcacaaaatttactttgt
gcccaaattttggtgacgaaaagtgattttcgcgatcgccgtcactatctgaatatgcaa
acctgtttgaacgcgctcctgaagcaaggtgtcattccgattgtcaatgaaaacgatgcg
atctccgtcacggagctgatgtttaccgacaacgatgaactttccggcctgattgcatcg
atgatgcaagccgaagctcttctcattttaaccaatgtggatggcgtttttgacggcaat
tttcacgagggaaacgcacaagtgatttcggaaatcaattccaaaaagctggattatagc
aaatatattaagccggtaaagtcctcatttggacgcggcggcatgttgaccaagtgcagc
attgcgcataagctctcgctgatgggcattacggtgcacatcgctaacggcaagaaatcg
ggcattttagaagaaattttgtctggcgtaagtgtgggcacaaagtttatttcgcaaaag
cgcacatccagcgtaaagcgttggatggcgcacgcagaaggctatgaaaaaggaacggtt
tttatcaatcgtggcgctgaagcggcgttgctttcgcatgagacggcgacaagccttttg
cccgtgggcgttttgcgcatagaaggcggatttaaaaaaggcgatattattaaaatttgc
aatgaacagaatgccacgctcggctacggcatggcgcaatacgactcgcaaaaagcggct
tctttgattggtcaaaaaggtcaaaagccgcttgtgcattacgattatttatttttaaag
caacctgaggcgtag

DBGET integrated database retrieval system