KEGG   Chloroherpeton thalassium: Ctha_1616Help
Entry
Ctha_1616         CDS       T00726                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cts  Chloroherpeton thalassium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1910791..1912056
Genome map
AA seq 421 aa AA seqDB search
MATVVWIDPGCCRHEKKCFQCSLKFQHQVFSDFLSEAVLRYSDSHLQLLPLQKDTTNTVF
YSKNKIKRGEIMKTRIFLLFAFLAISAISGGCSKKTETNTAMLDSTMLKPFKPLPEMVEA
DSNPITEEKIKLGRMLYFETRLSKSHKFSCNSCHSLTNYGVDNQPVSTGHKEQTGDRNSP
TVYNAAGHIAQFWDGRASDVEAQAKGPILNPVEMAMPDEATVVKTLKSIPGYEEIFKKAF
PDEKEPITFDNIAAAIGAFERKLVTPSRWDKFLNGDETALTDMEKKGAVKFINTGCVTCH
AGAYLGGQMFQKIGLVKPWHAQNDSGRYALTKKQGDAFVFKVASLRNVEKTAPYFHDGSV
DSLSQAVDMMGEYQLNKKLNAEDTEEIVAFLKTLTGELPKEYIAEPELPKDGPNTPKPVL
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtggtctggattgatccaggctgctgtcgccatgaaaaaaagtgcttccaa
tgttccctgaaatttcaacatcaagtattttccgatttcttatcagaagctgttcttaga
tatagtgattctcatttgcaattattacctttgcaaaaggatacaaccaacaccgtattc
tactcaaaaaacaaaataaaacgaggtgagatcatgaaaacacgcattttccttcttttt
gcgtttcttgccatttcggcaatttcaggtgggtgctcgaaaaaaacggaaacgaacacc
gccatgcttgatagcaccatgctaaaacccttcaagccgctgccggaaatggtagaggcc
gatagcaatccgattaccgaagaaaaaatcaaattggggcgaatgctctattttgagacc
cgtctatcaaaaagtcacaagttttcttgcaattcatgccactcgctcacaaactatggc
gttgataatcaacccgtttcaactgggcataaagagcaaacgggcgatagaaactcgcca
acggtttataatgccgccggacatatcgcgcaattttgggatgggcgcgcttcagatgtt
gaagcccaagccaaagggccgatcttgaatccagtggaaatggccatgccggatgaggca
actgttgttaaaacattgaaatccattccaggctacgaagaaattttcaaaaaagcattt
cctgacgaaaaagagcccatcacgttcgataacattgcggcggcaattggggcattcgag
cgcaagttggttacgccttcgcgttgggataaattcctaaatggggacgaaaccgcctta
accgacatggagaaaaaaggcgcagtaaagtttataaataccggctgcgtcacttgccac
gccggcgcttatttaggcggacagatgttccaaaaaatcgggcttgtgaagccgtggcat
gcacaaaacgacagcgggcgctatgcactgaccaaaaaacaaggcgatgcgtttgttttc
aaagtggccagccttcgcaatgttgaaaaaacagcgccttactttcatgatggttctgtt
gatagtttaagccaagccgtggatatgatgggagaatatcagcttaataaaaaattgaat
gcggaagataccgaagaaatcgtcgcgtttttgaaaacattgacgggcgagttgccaaaa
gagtatatcgctgagccggagcttccgaaagatggacctaacacgccgaaacccgtttta
aactaa

DBGET integrated database retrieval system