KEGG   Chloroherpeton thalassium: Ctha_1767Help
Entry
Ctha_1767         CDS       T00726                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cts  Chloroherpeton thalassium
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ctha_1767
Enzymes [BR:cts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ctha_1767
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Ctha_1767
Lipid biosynthesis proteins [BR:cts01004]
 Fatty acid synthase
  Component type
   Ctha_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2098350..2099009)
Genome map
AA seq 219 aa AA seqDB search
MKNAVLLSILLLFNTSLLSERLDPKSQSQAKAEKTILFFGNSITAGMGLRPSNAFPSLIQ
DKIDQLGWPFKVVNAGLSGETSAGGLRRINWILKKPADIFILELGANDGLRGISPETTKK
NLQGIIDLAKKKNPAMKMIIAGMQVPPNLGKAYTDSFQQIFPELAKENRAQLIPFLLEGV
GGQPNLNLPDGIHPNVEGHKMVAENVWKILEPLLKNDLN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgccgttctgctctcaattttattgttatttaatacttctttgctttccgaa
cggctcgatcccaaaagccaatcgcaggcaaaagccgaaaaaacgattctttttttcgga
aatagtattaccgctggcatgggacttcgcccaagcaacgcctttccttcgctcattcaa
gataaaatagatcagcttggctggccgtttaaagtggtgaatgccgggctaagtggcgaa
acgtctgcgggcggacttcggcgcatcaattggattttgaaaaagcctgcggacattttc
attctcgagcttggcgccaacgacggcttgcgcggcatttcgcccgaaaccaccaaaaaa
aatcttcaaggcattatcgatttggcgaaaaagaaaaatcccgctatgaaaatgatcatt
gcgggcatgcaagtgccaccaaacttgggcaaagcctataccgattcattccagcaaatt
tttcccgagcttgccaaagaaaatcgcgcccagcttattccgtttcttcttgagggcgtg
ggcggccagccaaatttgaacttacccgatggcattcatccaaatgtggaaggccataaa
atggtcgcagaaaatgtttggaaaattctggaaccgctgctcaaaaatgatttgaattaa

DBGET integrated database retrieval system