KEGG   Chloroherpeton thalassium: Ctha_1961Help
Entry
Ctha_1961         CDS       T00726                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cts00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cts00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cts02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2337959..2339851)
Genome map
AA seq 630 aa AA seqDB search
MKNFSLAMLILAIACFGVLTGCDNEEDKVTSTEETVKTATLSYTLDFSSALDEGFTITKI
VVAIAKDDFKDTLNITVADGETTASGSFSSLEAGTYTISIKAYNDTELIAEGSGEATVKA
GATATASIELQYTSGNLEIIITLPTTQGAKYIFFFIGDGMATPQINVTEAALGVDGFPTT
STEFLGKMNMNEFPVAGMATTYAEDRYITGSAAAATALATGHKTTINTISMNGERKLDLP
TMAEMAHDKGMKIGIVSSVSIDHATPAAFYAHTATRKNYEDIANYLVNSNFDYFAGGTVL
HNTYATGSPANSSLRDYASLSDFISHAEEKGYTYVNTKASLDAISSGKVIATIEKLETYT
ADGCALPYAIDLSAQSSENDQISLADFTQKGIDLLEDNEDGFFMMVEGGKVDWACHANDA
VTSILDMMAFDNAIGKALSFYNNHKDETLIVVTGDHECGGLTLGYTGTEYESAFELLQYQ
TISFQLFSEKVAAWAGNDVSGYSVEEDVTFEMALDSIKTYFGLGDIKLDEQMALSAYDST
RLEDAFNMSMNGETLKTDEENNILYGYYDPLTVTITHILNEKSGLSWTSYYHTAVPVPVL
AIGVDSDEFSGYYDNTDIANKIMEIGQLED
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttttcactcgcgatgctaattttagcaattgcgtgcttcggtgtcctgact
ggctgcgacaacgaagaagataaagtgacctcaacagaggaaacagttaaaaccgccacg
ttgtcctacacgttggacttctcttctgccttagatgaaggcttcacgattactaaaatc
gttgttgccattgcaaaagacgatttcaaggatacattaaacatcacggttgcagatggt
gaaaccacagcttccggttctttctcctcgctcgaagccggcacttacaccatcagcata
aaagcttataacgacacagagctgatcgctgaaggttctggtgaagcaacggttaaagcc
ggtgcaaccgcaaccgcctctatcgagcttcagtacacaagcggcaaccttgaaatcatt
attaccttaccaaccactcaaggtgcaaagtacattttcttcttcatcggcgacggtatg
gctacccctcaaatcaacgtgacagaagcagcacttggcgttgatggtttcccaaccacc
agcacggaattcctcggcaaaatgaacatgaacgaattcccagttgcaggtatggcaacc
acttatgcagaagatcgctacatcactggttctgccgctgcagccactgctttagccacc
ggccataagacaaccatcaacaccatttctatgaacggcgagcgcaaactcgaccttcca
acaatggctgaaatggcgcatgataaaggcatgaaaatcggcattgtttcaagcgttagc
atcgaccacgccacaccagctgcattctacgcacacaccgccaccagaaaaaattatgaa
gatatcgccaactatttggttaatagcaactttgactattttgctggtggaacggttctt
cataatacttatgcaactggctcacctgccaactcttcccttcgcgattatgcaagctta
agcgactttatctctcacgctgaagaaaaaggctacacttacgtaaatacgaaagcctcc
ctcgatgctatcagcagcggcaaagttatcgccaccattgaaaagttagaaacctacaca
gccgatggctgcgcacttccttatgcgattgacttaagcgctcagagcagcgaaaacgac
cagatcagcttggctgactttactcaaaaaggtatcgatcttttagaagacaatgaagat
ggcttcttcatgatggttgaaggcggtaaagttgactgggcttgccacgccaacgacgcg
gttacttctattctcgacatgatggcgtttgataacgcaattggaaaagcgctttctttc
tacaacaatcacaaagatgaaacgctcatcgttgttactggtgaccacgagtgcggcggt
ttaacgcttggctacactggcactgaatacgaatcagcttttgaacttttgcagtaccaa
accatctcgttccagcttttctctgaaaaagtggctgcatgggcaggcaacgatgtttct
ggctactctgttgaggaagatgttacctttgaaatggctcttgattctatcaaaacttac
ttcggtcttggtgatatcaagctcgacgagcaaatggcgctctcagcttacgattctacc
agacttgaagatgctttcaacatgagcatgaacggcgaaacgcttaagactgacgaagag
aataatattctctacggttactacgatccactaaccgttaccatcactcacattctcaac
gaaaagtcaggcctttcttggaccagctactatcacacagctgttcctgttcccgtgctt
gctattggcgtagattccgacgaattcagcggttactatgacaataccgatatcgcgaat
aaaatcatggaaatcggccaattagaagattaa

DBGET integrated database retrieval system