KEGG   Chloroherpeton thalassium: Ctha_2157Help
Entry
Ctha_2157         CDS       T00726                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ctha_2157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_2157
   00620 Pyruvate metabolism
    Ctha_2157
   00640 Propanoate metabolism
    Ctha_2157
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ctha_2157
   00680 Methane metabolism
    Ctha_2157
Enzymes [BR:cts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ctha_2157
Lipid biosynthesis proteins [BR:cts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ctha_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2572173..2574062
Genome map
AA seq 629 aa AA seqDB search
MATIETLIQERRKIVPPEFLRQGAIVQDYEALYQYSVASPERFWDTIASELSWNERWEKV
LEFVPPYHKWFIGGKTNITINALDRHVQSSRRNKVALIWTTENGKEIILTYDRLLRRVSQ
VANALKDVGVKKGDRVIIYMPLTVEGIYAMLACARIGAIHSVVYAGMGVHALRSRIDDSQ
AKVVFCSDVTYRSGKTIQLKGIVDEAVETCEFVEKVVVLRRQEPKVELSSEREADFFEFI
EGQPQYCEPEIMDSEDPLFILYTSGTTGKPKGVVHVHGGYMVGTYYLTKAFYDVKERDIF
WSTSDIGWIVGHSYIVYGPLINGATILAREGAIDYPDPGIIWKTVQRHGVNIMFTAPTAV
RMFMKYGADFVKKYDTSSLRLVACAGEPLNPEAHQWAQDNIVGENGYVVDNWWQTENAAP
VLGTLPAFDAKLGKVGRPMPGVVADVVSPDGKTVAPNQGGLLILKRPLPYMMRTIWGDDE
RYKKYWQDFPGCYTSGDVAFYDEDGYFCVLGRADDVMNIAGHRIGTAEVESAFITHPAVA
EAAVIGLPDEVKGERIKGFVVLKAGHNATENLKVVLRDHVRRELGPVATPSEIEFRDSLP
KTRSGKIVRRLLKAQDLGEDAGDLSTLSD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattgaaacactcattcaagaacgccgcaaaatagtccccccggaatttctt
cgtcaaggcgcgattgttcaagactatgaagcgctgtatcagtattcagtggcttcacca
gagcgattttgggatacgattgcctctgagctaagttggaacgagcgttgggaaaaagtt
ctagaatttgtgcccccttaccataagtggtttattggcggtaaaacgaacattactatt
aatgctttggatcggcatgttcaaagttcaaggcgaaataaagtcgcgttgatttggaca
acagaaaatggaaaagaaatcattttgacttatgatcggttgctcaggcgagttagccaa
gtggcgaacgcgctaaaagatgttggggtgaaaaaaggggatagggtaattatctacatg
cccctaacggtagaaggtatttatgcaatgcttgcgtgtgctcgtattggcgcaattcat
tcggttgtgtatgcgggaatgggcgttcatgcgttgcgctcaagaattgatgatagtcaa
gcaaaagtcgtcttttgttcggatgtgacttatcgatctggcaaaaccattcagttaaag
ggaattgtcgatgaagccgtagagacttgtgaatttgtagaaaaagtggttgtattaagg
cgtcaagagccaaaagtagagcttagctcagagcgtgaagcggacttctttgagtttatt
gaaggccagccgcaatattgtgagcctgaaatcatggactctgaagatcctttgttcatt
ctttatacaagtggaacaacgggcaaaccaaaaggggttgtgcatgttcatggcggttac
atggttgggacttattatttaacaaaagctttttacgacgtaaaagagcgcgatattttt
tggagcacgtcggatattggttggattgtcggacatagttatatcgtttatggtcctcta
attaatggcgcaacgatactggccagggaaggcgcaatagattatccagatcctggtatt
atatggaaaacagtgcagcgtcatggggtcaatatcatgtttacagcgcccacagcggtt
agaatgtttatgaagtatggggctgattttgtaaagaaatatgatacctcatcgttgcga
ctggttgcctgtgctggagaaccattaaatccagaagcacatcagtgggcgcaggataat
attgttggtgaaaatgggtatgtggttgacaactggtggcaaacagaaaacgcagcgcca
gttttggggacgctaccggcttttgatgcaaagcttggtaaagtcgggcgtcctatgcca
ggagtggtagcagacgtggtctcgccggatggtaagacggttgccccaaatcagggcggg
ttgttgattttgaagcgccctcttccgtatatgatgcgaaccatttggggcgatgatgaa
cggtataaaaaatactggcaggattttcctggttgttataccagtggcgatgtcgctttt
tatgatgaagacggttacttctgtgtgttgggcagagctgatgatgtcatgaatattgcc
ggtcatcgaattggtactgccgaagttgaaagtgcgtttatcacacatccggcggtagct
gaagcagctgtgattggtttgccagatgaagttaagggcgaaagaattaaaggatttgtt
gttttgaaagcagggcataatgccaccgaaaatctcaaagtggtgctgagagatcatgtg
cgcagagagctggggccagtggcgacaccaagcgaaattgaattcagagattctttgcca
aaaaccagaagtggcaaaattgtgcgaagattattgaaagcccaagatcttggagaagat
gcgggagacctttcaacactttctgattaa

DBGET integrated database retrieval system