KEGG   Chloroherpeton thalassium: Ctha_2159Help
Entry
Ctha_2159         CDS       T00726                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cts  Chloroherpeton thalassium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ctha_2159
   01230 Biosynthesis of amino acids
    Ctha_2159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ctha_2159
  Energy metabolism
   00680 Methane metabolism
    Ctha_2159
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ctha_2159
Enzymes [BR:cts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ctha_2159
Exosome [BR:cts04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ctha_2159
  Exosomal proteins of melanoma cells
   Ctha_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576037..2576786
Genome map
AA seq 249 aa AA seqDB search
MIKLVLLRHGESVWNKENRFTGWKDVDLTEKGVQEAKRAGEFMKKEGLDFDIAYTSVLKR
AIRTLNLALNEMDLQWIPVNKTWRLNERHYGALQGLNKSETAEKFGEEQVLIWRRSYDTP
PPALEKSDERYPGHDPRYKDLTEAELPLTECLKDTVERFLPYWHETIAPTIKSGKRVIIA
AHGNSLRSLVKYLDNISDEDIVGLNIPTGMPLVYELDDDMKPIKNYYLGDPDDVAKAMAS
VANQGKAKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattagttctcttgcggcacggcgaaagcgtgtggaacaaggaaaatcgcttt
accggctggaaagacgtcgacctaaccgaaaaaggcgttcaggaagccaaacgcgccggc
gaatttatgaaaaaagaaggcttggattttgacattgcctacacatccgttctgaaacgc
gccattcgcacgctcaaccttgcgctcaatgaaatggatttgcagtggattccggtcaat
aaaacttggcgcctcaacgaacgccactacggtgcgcttcaaggattgaacaaatccgag
accgccgaaaagttcggtgaagagcaagtgctgatttggcgtagaagttacgatacaccg
ccgccagctttggaaaaatccgacgaacgctatccgggacacgacccgcgctacaaagac
ctcaccgaagccgaacttcctttgaccgaatgcttgaaagacaccgtcgagcggtttttg
ccgtactggcacgaaaccattgcgccgaccatcaagtccggcaagcgcgtcatcattgcc
gcacatggcaattcgcttcgttcgttggtaaaatatttggacaacatttccgacgaagac
attgtcggcctgaacattccgaccggcatgccgctcgtctatgaattggacgacgacatg
aagccgattaaaaactactacttgggcgacccggacgatgtcgcaaaagcgatggcttcg
gttgcgaatcaaggtaaagcgaaagcttaa

DBGET integrated database retrieval system