KEGG   Chloroherpeton thalassium: Ctha_2176Help
Entry
Ctha_2176         CDS       T00726                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cts  Chloroherpeton thalassium
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cts00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cts00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2605329..2606288)
Genome map
AA seq 319 aa AA seqDB search
MRVFFSKSILFIAVKHLLGLYHTSHHDISSILDLASFYKKSIMETPSEHFSDLMGKIIVL
AFFENSTRTRTSFDLAARKLGASTVNFTASASSIQKGETMLDTIATLEAMQVDAFIVRHK
DSGAPHTIAKHSRKTIINAGDGTHEHPTQALLDMLTLQETFGKLNGLKILILGDILHSRV
ARSNIFGLQKMGAEVSVCAPTTLLPTAINAFGVKVYHDLNRAVSEVDAVIVLRIQLERES
GGYIPSINEYSSFYALTEEKLSERNGKLVVLHPGPINREIELSGIIADETCEKAPSQSKI
LNQVTNGIAVRMSVLKHLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgttttttagtaaatccatcctgtttattgctgtgaaacacttacttgggtta
taccacacatcgcatcacgacatttcttccattttggacttggcaagcttctacaaaaaa
tccattatggaaacgccatcggaacatttttctgatttaatgggaaaaatcattgtcctc
gctttttttgaaaattccacccgcacacgcacctctttcgatttggccgcgcgaaaatta
ggcgcatctacagtgaattttaccgcttctgccagcagcattcaaaaaggcgaaaccatg
ctcgatacgattgccacgcttgaagccatgcaagtcgatgcgtttatcgttcggcataaa
gattccggtgcgccgcataccatcgcgaagcacagtcgcaaaaccatcatcaatgccggc
gacggcacgcatgaacatcccacccaagccttgctcgacatgctcaccctgcaagaaact
ttcggaaaacttaacggcctgaaaatcttgattctcggcgatattcttcacagccgtgtt
gcacgatcaaatatttttgggctacaaaaaatgggtgcggaagtttcggtttgtgcccca
acaacgctgttgccgacggccatcaatgcgtttggcgtgaaggtttatcatgatttaaat
cgagccgtttctgaagtggatgcggtaattgtactgagaattcagctcgagcgagaatcc
ggcggctacattccatccatcaatgaatattcctctttttatgccttaacggaggaaaaa
ctctcggagcgaaatggcaagcttgtcgttttgcatccgggccccatcaacagagaaatt
gaactttccgggatcatcgccgacgaaacctgcgaaaaagcgccatcacaaagcaaaatc
ttaaaccaagtgacaaacggcatcgcagtgcgaatgtccgttttgaaacatcttctttaa

DBGET integrated database retrieval system