KEGG   Chloroherpeton thalassium: Ctha_2176Help
Entry
Ctha_2176         CDS       T00726                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00240  Pyrimidine metabolism
cts00250  Alanine, aspartate and glutamate metabolism
cts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ctha_2176
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ctha_2176
Enzymes [BR:cts01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ctha_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ACF14627
JGI: Ctha2176
UniProt: B3QVX3
Position
complement(2605329..2606288)
Genome map
AA seq 319 aa AA seqDB search
MRVFFSKSILFIAVKHLLGLYHTSHHDISSILDLASFYKKSIMETPSEHFSDLMGKIIVL
AFFENSTRTRTSFDLAARKLGASTVNFTASASSIQKGETMLDTIATLEAMQVDAFIVRHK
DSGAPHTIAKHSRKTIINAGDGTHEHPTQALLDMLTLQETFGKLNGLKILILGDILHSRV
ARSNIFGLQKMGAEVSVCAPTTLLPTAINAFGVKVYHDLNRAVSEVDAVIVLRIQLERES
GGYIPSINEYSSFYALTEEKLSERNGKLVVLHPGPINREIELSGIIADETCEKAPSQSKI
LNQVTNGIAVRMSVLKHLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgttttttagtaaatccatcctgtttattgctgtgaaacacttacttgggtta
taccacacatcgcatcacgacatttcttccattttggacttggcaagcttctacaaaaaa
tccattatggaaacgccatcggaacatttttctgatttaatgggaaaaatcattgtcctc
gctttttttgaaaattccacccgcacacgcacctctttcgatttggccgcgcgaaaatta
ggcgcatctacagtgaattttaccgcttctgccagcagcattcaaaaaggcgaaaccatg
ctcgatacgattgccacgcttgaagccatgcaagtcgatgcgtttatcgttcggcataaa
gattccggtgcgccgcataccatcgcgaagcacagtcgcaaaaccatcatcaatgccggc
gacggcacgcatgaacatcccacccaagccttgctcgacatgctcaccctgcaagaaact
ttcggaaaacttaacggcctgaaaatcttgattctcggcgatattcttcacagccgtgtt
gcacgatcaaatatttttgggctacaaaaaatgggtgcggaagtttcggtttgtgcccca
acaacgctgttgccgacggccatcaatgcgtttggcgtgaaggtttatcatgatttaaat
cgagccgtttctgaagtggatgcggtaattgtactgagaattcagctcgagcgagaatcc
ggcggctacattccatccatcaatgaatattcctctttttatgccttaacggaggaaaaa
ctctcggagcgaaatggcaagcttgtcgttttgcatccgggccccatcaacagagaaatt
gaactttccgggatcatcgccgacgaaacctgcgaaaaagcgccatcacaaagcaaaatc
ttaaaccaagtgacaaacggcatcgcagtgcgaatgtccgttttgaaacatcttctttaa

DBGET integrated database retrieval system