KEGG   Chloroherpeton thalassium: Ctha_2267Help
Entry
Ctha_2267         CDS       T00726                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00020  Citrate cycle (TCA cycle)
cts00640  Propanoate metabolism
cts00660  C5-Branched dibasic acid metabolism
cts00720  Carbon fixation pathways in prokaryotes
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01120  Microbial metabolism in diverse environments
cts01130  Biosynthesis of antibiotics
cts01200  Carbon metabolism
Module
cts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cts_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cts_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ctha_2267
   00640 Propanoate metabolism
    Ctha_2267
   00660 C5-Branched dibasic acid metabolism
    Ctha_2267
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ctha_2267
Enzymes [BR:cts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ctha_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF3182
Motif
Other DBs
NCBI-ProteinID: ACF14718
JGI: Ctha2267
UniProt: B3QWF8
Position
complement(2724050..2725228)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKEILRGFGVTVPKGIVAFSAEEAKKAAETLLTEQGGGVVVVKAQIHAGGRGK
AGGVKLVRSADEAFEVATQMIGTTLVTHQTGPEGKEVRRLLVEEGMNIEKELYLGITLDR
ATSCNVLMVSTEGGMEIEKVAEETPEKLLKIQIHPTLGLQPNQAREAAFFLGLEGEQFKN
AVKFISALYNAYMKADCSLAEINPLVVTKEGRVIALDAKINFDDNALFRHKDYIDLRDTS
EEDPLEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGKPANFLDVGGGANPQ
TVQEGFRIILTDPNVKAILVNIFGGIVRCDRVAGGVIEAAKNIDIHVPVIVRLEGTNADI
AQKMLDESGLNLVSAKGLSDAAKKVNEALAAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaaggaaaagaaattttgcgtggctttggcgtcacggttccg
aagggaattgtggcgttttcggcagaggaggccaagaaagcagccgaaacgcttttgacg
gagcaaggcggcggtgtggttgtggtgaaagcgcaaattcacgcaggcggtcgcggaaaa
gctggcggcgtaaagctcgtgcgctctgccgatgaagcgtttgaagttgcgacacaaatg
atcggcacaacacttgttacgcaccaaaccggcccggaaggaaaagaagttcgccggctt
ttggttgaagaaggtatgaacatcgagaaagaactttatctcggcatcacgcttgaccgc
gccacaagctgcaatgtgctcatggtttcgaccgaaggcggcatggaaattgaaaaagta
gccgaagaaacaccggaaaaattgctcaaaattcaaattcacccgactttgggtttgcag
ccaaaccaagcacgcgaggccgcgttttttcttggtcttgaaggcgagcagttcaaaaat
gcggtgaagtttatttctgcgctctacaatgcgtacatgaaagccgattgttcgctggct
gaaatcaatccattggttgtgacgaaggaaggccgtgttattgcgcttgatgcgaaaatc
aattttgatgacaatgccctcttccgccacaaggattacattgatttgagagacacgagc
gaggaagatccgctggaagtcgaagcgtcaaaatcgaatttgaactatgttcgcttggac
ggaaacgtcggctgcatggtcaatggcgcaggtttggcgatgggaacaatggacatgatt
cagcttgcgggcggaaaaccggcgaacttcttggatgtcggcggtggcgccaatccacaa
accgttcaagaaggcttccgcattattttgaccgacccgaacgtgaaggccattttggtc
aatatcttcggcggcatcgttcgctgcgaccgtgtggcgggcggcgtgattgaagcggcg
aaaaacatcgacattcatgtgccggtgattgtccgcttggaaggtacaaacgccgacatc
gcgcaaaaaatgttggatgagtccggcttgaacctggtttcggcaaaaggcttgagcgac
gctgcgaaaaaagtcaacgaagcgcttgcggctgcctaa

DBGET integrated database retrieval system