KEGG   Chloroherpeton thalassium: Ctha_2267Help
Entry
Ctha_2267         CDS       T00726                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cts  Chloroherpeton thalassium
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:cts01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cts00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cts00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:cts00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:cts00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2724050..2725228)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKEILRGFGVTVPKGIVAFSAEEAKKAAETLLTEQGGGVVVVKAQIHAGGRGK
AGGVKLVRSADEAFEVATQMIGTTLVTHQTGPEGKEVRRLLVEEGMNIEKELYLGITLDR
ATSCNVLMVSTEGGMEIEKVAEETPEKLLKIQIHPTLGLQPNQAREAAFFLGLEGEQFKN
AVKFISALYNAYMKADCSLAEINPLVVTKEGRVIALDAKINFDDNALFRHKDYIDLRDTS
EEDPLEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGKPANFLDVGGGANPQ
TVQEGFRIILTDPNVKAILVNIFGGIVRCDRVAGGVIEAAKNIDIHVPVIVRLEGTNADI
AQKMLDESGLNLVSAKGLSDAAKKVNEALAAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaaggaaaagaaattttgcgtggctttggcgtcacggttccg
aagggaattgtggcgttttcggcagaggaggccaagaaagcagccgaaacgcttttgacg
gagcaaggcggcggtgtggttgtggtgaaagcgcaaattcacgcaggcggtcgcggaaaa
gctggcggcgtaaagctcgtgcgctctgccgatgaagcgtttgaagttgcgacacaaatg
atcggcacaacacttgttacgcaccaaaccggcccggaaggaaaagaagttcgccggctt
ttggttgaagaaggtatgaacatcgagaaagaactttatctcggcatcacgcttgaccgc
gccacaagctgcaatgtgctcatggtttcgaccgaaggcggcatggaaattgaaaaagta
gccgaagaaacaccggaaaaattgctcaaaattcaaattcacccgactttgggtttgcag
ccaaaccaagcacgcgaggccgcgttttttcttggtcttgaaggcgagcagttcaaaaat
gcggtgaagtttatttctgcgctctacaatgcgtacatgaaagccgattgttcgctggct
gaaatcaatccattggttgtgacgaaggaaggccgtgttattgcgcttgatgcgaaaatc
aattttgatgacaatgccctcttccgccacaaggattacattgatttgagagacacgagc
gaggaagatccgctggaagtcgaagcgtcaaaatcgaatttgaactatgttcgcttggac
ggaaacgtcggctgcatggtcaatggcgcaggtttggcgatgggaacaatggacatgatt
cagcttgcgggcggaaaaccggcgaacttcttggatgtcggcggtggcgccaatccacaa
accgttcaagaaggcttccgcattattttgaccgacccgaacgtgaaggccattttggtc
aatatcttcggcggcatcgttcgctgcgaccgtgtggcgggcggcgtgattgaagcggcg
aaaaacatcgacattcatgtgccggtgattgtccgcttggaaggtacaaacgccgacatc
gcgcaaaaaatgttggatgagtccggcttgaacctggtttcggcaaaaggcttgagcgac
gctgcgaaaaaagtcaacgaagcgcttgcggctgcctaa

DBGET integrated database retrieval system