KEGG   Chloroherpeton thalassium: Ctha_2419Help
Entry
Ctha_2419         CDS       T00726                                 

Definition
deoxyribodipyrimidine photo-lyase
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
cts  Chloroherpeton thalassium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2900707..2902140
Genome map
AA seq 477 aa AA seqDB search
MNRIIVWHRRDLRIFDHSALAEAAKFADEIIPIFILDDDILLRREDFSPACVGFMLESLE
ALALSYANIGGKLIVRRGQVLEVLKSLVGETRAQAIYFNEDYEPFAKMRDQAVQSEFEKL
GVRVKAFTDQVCFHPQRVLKDNGQPYTVFTPYQKKWLALSGNIPTPQPALTRISTPELPS
IPLPKTSDIRKKFSVQPIVQGGEPKGLKRLRAFLSQNIYHYKELRDFPATNATSLLSADL
RFGTLSIRHVFHESMRLVPQASEPAREGIQTFISELIWREFYFQILDHFPHVEKHSFKPE
FENLKWENNEVFFEAWKNGQTGYPIVDAAMRALRQTGWMHNRLRMIVASFLTKDLLIDWR
WGELYFMQHLIDGDLAANNGGWQWSASTGTDAQPYFRIFNPVLQSQKFDPKGEFIRKYVP
ELQAVPVRYIHFPAEILRKSPLLAREIGVALGKDYPHPIVEHKVQREKALRLYKAMP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattatcgtttggcatcgaagagatttgagaatttttgatcattccgcgctc
gcggaagctgcgaaattcgccgatgaaatcattccgattttcattttagatgacgacatt
ttgctccgacgcgaggatttttcgccggcgtgcgtgggctttatgttggaatcgctggaa
gccttagcgttgagctacgcaaacatcggcggaaaattgattgtgaggcgaggtcaagtt
ttggaagttttaaaatcgcttgttggggaaacgcgcgcgcaggcgatttacttcaacgaa
gattatgagccgttcgccaaaatgcgcgatcaagccgtgcaatccgaatttgagaaattg
ggcgttcgagtgaaagcattcaccgaccaagtttgttttcatccgcagcgcgttttgaaa
gataacggtcaaccctacacggttttcacgccatatcagaaaaaatggctggctttatct
ggaaacattccaacgccgcagcccgcgctcacgcgaatttctacgccggaacttccctct
ataccgctgcccaaaacgagcgacattcgcaaaaaattcagcgtccagccgattgtgcaa
ggcggcgagccgaaagggctgaagcgactgcgcgcgtttctttcgcagaacatttatcat
tataaagaacttcgcgattttcccgcaacgaatgcaaccagcttgctttcggctgatttg
cgattcggcaccctttctattcgccacgtttttcatgaatcaatgcgccttgtacctcaa
gcaagtgagccagcacgagaaggcattcagacatttatttcagagctgatttggcgagaa
ttttatttccagattttggatcattttccgcatgtggaaaaacacagcttcaagccggaa
tttgaaaatttgaaatgggaaaataacgaggtgttttttgaagcttggaaaaatgggcaa
accggctatccgattgtggatgcggcgatgcgagcgcttcgccaaaccggctggatgcac
aaccgcttgcgcatgattgtagccagttttctcacgaaggatttgctcatcgattggcgc
tggggcgaactttattttatgcaacatctcatcgacggcgatttggcagcaaacaacggc
ggttggcaatggtcagcctctaccggaacggatgcacaaccctatttccgaattttcaat
cccgttttgcaatcgcaaaaatttgacccgaaaggtgagtttatccgaaaatatgtgccc
gaactgcaagccgttcccgtccgctatattcactttcctgctgaaattcttagaaaatca
ccgcttttggcgcgggaaattggcgtggcacttgggaaagattatccgcatcctattgta
gaacacaaagtccagcgagaaaaggcgcttcggctctacaaagcgatgccgtag

DBGET integrated database retrieval system