KEGG   Chloroherpeton thalassium: Ctha_2419Help
Entry
Ctha_2419         CDS       T00726                                 

Definition
(GenBank) Deoxyribodipyrimidine photo-lyase (EC:4.1.99.3)
  KO
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
cts  Chloroherpeton thalassium
Brite
Enzymes [BR:cts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     Ctha_2419
DNA repair and recombination proteins [BR:cts03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    Ctha_2419
 Prokaryotic Type
    Ctha_2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2900707..2902140
Genome map
AA seq 477 aa AA seqDB search
MNRIIVWHRRDLRIFDHSALAEAAKFADEIIPIFILDDDILLRREDFSPACVGFMLESLE
ALALSYANIGGKLIVRRGQVLEVLKSLVGETRAQAIYFNEDYEPFAKMRDQAVQSEFEKL
GVRVKAFTDQVCFHPQRVLKDNGQPYTVFTPYQKKWLALSGNIPTPQPALTRISTPELPS
IPLPKTSDIRKKFSVQPIVQGGEPKGLKRLRAFLSQNIYHYKELRDFPATNATSLLSADL
RFGTLSIRHVFHESMRLVPQASEPAREGIQTFISELIWREFYFQILDHFPHVEKHSFKPE
FENLKWENNEVFFEAWKNGQTGYPIVDAAMRALRQTGWMHNRLRMIVASFLTKDLLIDWR
WGELYFMQHLIDGDLAANNGGWQWSASTGTDAQPYFRIFNPVLQSQKFDPKGEFIRKYVP
ELQAVPVRYIHFPAEILRKSPLLAREIGVALGKDYPHPIVEHKVQREKALRLYKAMP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattatcgtttggcatcgaagagatttgagaatttttgatcattccgcgctc
gcggaagctgcgaaattcgccgatgaaatcattccgattttcattttagatgacgacatt
ttgctccgacgcgaggatttttcgccggcgtgcgtgggctttatgttggaatcgctggaa
gccttagcgttgagctacgcaaacatcggcggaaaattgattgtgaggcgaggtcaagtt
ttggaagttttaaaatcgcttgttggggaaacgcgcgcgcaggcgatttacttcaacgaa
gattatgagccgttcgccaaaatgcgcgatcaagccgtgcaatccgaatttgagaaattg
ggcgttcgagtgaaagcattcaccgaccaagtttgttttcatccgcagcgcgttttgaaa
gataacggtcaaccctacacggttttcacgccatatcagaaaaaatggctggctttatct
ggaaacattccaacgccgcagcccgcgctcacgcgaatttctacgccggaacttccctct
ataccgctgcccaaaacgagcgacattcgcaaaaaattcagcgtccagccgattgtgcaa
ggcggcgagccgaaagggctgaagcgactgcgcgcgtttctttcgcagaacatttatcat
tataaagaacttcgcgattttcccgcaacgaatgcaaccagcttgctttcggctgatttg
cgattcggcaccctttctattcgccacgtttttcatgaatcaatgcgccttgtacctcaa
gcaagtgagccagcacgagaaggcattcagacatttatttcagagctgatttggcgagaa
ttttatttccagattttggatcattttccgcatgtggaaaaacacagcttcaagccggaa
tttgaaaatttgaaatgggaaaataacgaggtgttttttgaagcttggaaaaatgggcaa
accggctatccgattgtggatgcggcgatgcgagcgcttcgccaaaccggctggatgcac
aaccgcttgcgcatgattgtagccagttttctcacgaaggatttgctcatcgattggcgc
tggggcgaactttattttatgcaacatctcatcgacggcgatttggcagcaaacaacggc
ggttggcaatggtcagcctctaccggaacggatgcacaaccctatttccgaattttcaat
cccgttttgcaatcgcaaaaatttgacccgaaaggtgagtttatccgaaaatatgtgccc
gaactgcaagccgttcccgtccgctatattcactttcctgctgaaattcttagaaaatca
ccgcttttggcgcgggaaattggcgtggcacttgggaaagattatccgcatcctattgta
gaacacaaagtccagcgagaaaaggcgcttcggctctacaaagcgatgccgtag

DBGET integrated database retrieval system