KEGG   Chloroherpeton thalassium: Ctha_2443Help
Entry
Ctha_2443         CDS       T00726                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00860  Porphyrin and chlorophyll metabolism
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ctha_2443
Enzymes [BR:cts01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ctha_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 VWA_2 VWA VWA_CoxE Sigma54_activat MCM DUF1510 AAA_22 AAA_16 SAPS Plasmodium_Vir
Motif
Other DBs
NCBI-ProteinID: ACF14892
JGI: Ctha2443
UniProt: B3QX82
Position
complement(2930567..2932594)
Genome map
AA seq 675 aa AA seqDB search
MMHKHLFPFSAIIGQADLKLCLILNAVNPKVGGVVIRGEKGTAKSTAVRALSALLPEVES
QPMAELHDGTKSQIVEKHRPSVVTLPLNATEDCVVGGIDFNLTIREGHRVFQPGLLAKAH
HGILYVDEVNLLDDHIVDVVLDAAASGENHIEREGMSFKHPSEFILVGTMNPEEGELRPQ
LLDRFGLCVEVQSERDPEHRVDLILRREAFDSDPIVFIESYQAENDRLAQKIAKAKKLFT
EVKMPPHLRSFISELCRENNVAGHRADLVIEHAARAHAAYRSQLEVGVEDIKIVAPFALS
HRRRDPIPPPPPEPPQPEEQDEPEQQEQEQPEPEENRQQEQPQPEAQNQPEGEGEEREQP
QQEQQGNNQEEQDSPDEKNEDDERSPEEAHEQVLEQIFDIGATFKVKKFSTPKDRNKRRG
SGRRSRSKVSQKQGRYIRSTSKRSNDDIALDATLRAAAPHQRHRDNPNGMAVALHESDIH
EKIREKRVGNLLLFVVDASGSMGARGRMAASKGAVMSLLLDAYQKRDKVAMVSFRKKEAW
VNLPITSSVEVAGKLLKDMPVGGRTPFSAGLVKGYELCKNYLLKEPTARPIMIIISDGKA
NFALGNQKPMDEVYAVARKMAEEARIRFIVVDTEEAGLVSFGLASKISAMLSADYFKIDD
LKSDQLLSIVKDSMK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacaaacacttgtttccgttttcagccataattgggcaggcggacttaaagctt
tgcctgattttaaatgccgtgaatccaaaggtcggcggcgtggtcattcgcggggaaaaa
ggcacggcgaagtcgactgcggtgcgggcgttgagcgcgcttttgcccgaagtcgaatcg
cagccgatggccgaattgcacgacggcacaaaaagccaaattgttgaaaagcatcgcccg
tcggtggtcaccttgccgctcaacgcaacggaggattgcgtggtcggcggcatcgatttt
aatttgaccatcagagaagggcaccgggtgtttcagcccggattgctcgccaaagcgcat
cacggcattttgtatgtcgacgaggtgaatttgttggacgaccacatcgtggatgtcgtt
ttggatgcggcggcttcgggtgaaaatcacattgagcgcgaaggcatgtcgttcaagcat
ccgtcggaatttattttggtcgggacaatgaacccggaagaaggcgagcttcgcccgcag
cttctcgatcggttcggactttgcgtagaagttcagtccgagcgcgaccccgaacatcgc
gtggatctcattttgcgccgcgaagctttcgactcggacccgatcgtatttatcgaaagc
tatcaagccgaaaacgatcgactggcgcaaaaaatagccaaagccaaaaagcttttcacc
gaagtgaaaatgccgccgcatttgcgctcgttcatctcggagctttgccgcgaaaataac
gtggccggacatcgcgcggatttggtgattgagcacgccgctcgggcgcacgcggcttat
cgttcgcagcttgaagtcggtgtggaggacatcaaaattgttgcgccgtttgcgttgtcg
catcgccggcgcgaccccattccgcccccgccgcccgaaccgcctcagccggaagagcag
gacgaaccggagcaacaagaacaagagcagcccgaaccggaggaaaaccgtcaacaagaa
cagccgcaacccgaagcgcaaaatcagcccgaaggtgagggcgaagaacgcgagcagccg
cagcaagaacagcagggcaacaaccaagaagagcaggactcgccggacgagaaaaacgag
gacgacgagcgctcgccggaggaagcgcatgaacaagttttggagcaaattttcgacatc
ggcgcaaccttcaaagtgaagaaattttccacgccgaaggatcgcaacaagcggcgcggt
tcgggtcggcggtcgcggtcaaaggtttcgcagaagcaaggccgctacattcgtagcacc
tcgaagcgcagcaatgacgacatcgcgctcgatgccacgcttcgcgccgccgcgccgcac
cagcgacaccgcgacaatccgaacggcatggccgtcgccctgcacgaaagcgatattcac
gagaaaatccgcgaaaagcgcgtcggcaatttgctgctgttcgttgtcgacgccagcgga
tcgatgggcgctcgcgggcgcatggcggcctcgaaaggcgcggtcatgtcgctcttgctc
gatgcgtatcaaaagcgcgacaaggtggcgatggtctcgtttcgcaaaaaagaagcttgg
gtaaatttgcccatcacctcgtcggtggaagttgcaggaaaacttttgaaagacatgccc
gtcggcggtcgcacgccgttttccgccggacttgtcaaaggctacgagctttgtaaaaac
tatctgctcaaagagccgacagcccgccccatcatgattatcatctcggacggcaaggcc
aattttgcgctcggcaatcaaaagccgatggacgaagtttatgcggtggcgcgaaaaatg
gcggaggaagcgcgcatccgtttcatcgtggtggatacggaagaggccgggctggtctcg
ttcgggctggcgtccaaaatttcggccatgctcagcgcagactatttcaaaatagacgat
ttaaaatccgatcaacttttaagcattgtaaaggacagcatgaaatga

DBGET integrated database retrieval system