KEGG   Chloroherpeton thalassium: Ctha_2504Help
Entry
Ctha_2504         CDS       T00726                                 

Definition
magnesium chelatase subunit ChlI family
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ctha_2504
Enzymes [BR:cts01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ctha_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3011080..3012660
Genome map
AA seq 526 aa AA seqDB search
MPHFVQLDIGQSDSRNKKSFISAVQTYLIMTHQNMAELTKAKTIGDLKSLGYRARSVKDE
IRENLIAKLKNREDIFPGIMGYERTVIPQLQNALLSKHDIILLGLRGQAKTKLIRMLSTL
LDEFTPIIKGSEINDDPFNPLSKFGREKVLHEGDETDIEWLHRSERYSEKLATPDVTIAD
LIGDIDPIKAATHRLTYADENVIHFGLIPRTNRGIFAINELPDLQPRIQVGLLNIMQEKD
IQIRGFQVRIPLDIFIIYSANPEDYTNRGNIITPLKDRIDSQIITHYPKTVEIGIQITER
EAWTKRSSAKIEVPYYFKEIIEHTAFEARRSEYVDQKSGVSARLTISAMENLVSNAERRA
ILNNESDATVRISDIFYAVPAVTGKIELVYEGEQEGAQNVSKVLLGKAINQVFKKYCPDP
NKKAQGKNVYSSIMDWFSKGNQLTILDDMSFADYYTLLDSVKGLKDLAQKLLNPQEKTEL
ATAMEFILEGLHQNSMIGKDELEASRSYSDMIGKIMSSVGGNRYER
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactttgttcagcttgacattggccaatccgactcaagaaataaaaagagcttt
atttcagcagttcaaacttatttgattatgacccaccaaaatatggctgagcttacaaaa
gcaaaaacaatcggcgatttaaaaagccttggctatcgcgctcgctcggtaaaagatgag
attcgcgagaatttaattgcaaagctaaaaaaccgcgaggatatctttccgggcattatg
ggctatgagcgaactgtcattccacaactgcaaaacgcgctactttccaagcacgacatc
attttgctgggacttcgcggacaagccaaaaccaaactcattcgcatgctcagcacgctc
ctggatgaattcacgccgattatcaaaggctcagaaatcaacgacgatccgttcaatccg
ctttcaaaattcggcagggaaaaagtgcttcacgaaggcgacgagaccgatatcgaatgg
ctgcatcgctcggagcgttacagcgaaaaactcgcaacgccggatgtcacgattgccgat
ctcatcggcgacatcgatccgattaaagccgcaacgcaccgcttaacttatgcagatgaa
aatgttatccatttcggcctgattccacgcaccaatcgcggcattttcgccatcaacgag
ttgcccgatttgcagccgcgcattcaagttggcctgctcaacatcatgcaggaaaaagac
atccaaattcgcggctttcaagttcgcattccgctcgatatttttatcatctactcggca
aatcctgaagattacaccaatcgcggcaacatcatcacgccgctcaaagatcgcattgat
tcgcaaatcatcacgcattatcccaaaacggtggagattggcattcaaatcacagagcgc
gaagcttggacaaagcgcagttccgcaaaaattgaagtgccgtattattttaaagaaatt
atcgaacacacggcgtttgaagcacgacgcagcgaatacgtggatcaaaaatccggtgtc
tcggcgcgattgacgatttccgccatggaaaacttggtgagcaacgctgagcgccgcgcg
attctcaataacgaatcggatgcaacggttcgcatttcggacattttttatgcggttcct
gctgttacgggaaaaatcgagctcgtttatgaaggcgaacaagaaggcgctcaaaatgta
tctaaagtcttgctcggaaaggctatcaaccaagttttcaaaaaatattgccctgatccg
aacaagaaagcgcaagggaaaaatgtttattcgtcgattatggattggttttcaaaagga
aatcagctcaccattcttgacgacatgagcttcgctgattattataccttgctcgacagt
gtaaaaggcctaaaagacctggcgcaaaagcttctgaatcctcaagaaaaaacggaactc
gccacagcgatggaatttattttggaaggacttcatcaaaattcgatgattggaaaagat
gagttggaagcgtcgcgctcctattccgacatgattggaaaaatcatgagcagtgttggg
ggcaatcgctacgaacgttga

DBGET integrated database retrieval system