KEGG   Chloroherpeton thalassium: Ctha_2525Help
Entry
Ctha_2525         CDS       T00726                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00260  Glycine, serine and threonine metabolism
cts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cts01100  Metabolic pathways
cts01110  Biosynthesis of secondary metabolites
cts01130  Biosynthesis of antibiotics
cts01230  Biosynthesis of amino acids
Module
cts_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ctha_2525
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ctha_2525
Enzymes [BR:cts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ctha_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Interfer-bind
Motif
Other DBs
NCBI-ProteinID: ACF14974
JGI: Ctha2525
UniProt: B3QXQ9
Position
complement(3032217..3033044)
Genome map
AA seq 275 aa AA seqDB search
MSTTTGEKSRISFLIKSNQKLLISYLMPEFPVRGATVPAMLALQNAGANMIELGVPHSDP
LADGPVIQKAAQIALENGVNLKQVLTFVIEARRAGLKIPVFLMGYYNPLFAYGIDKFLAD
AVAAGVDGFIVPDLPPEESHEFLEKCKQNQLALTFLISPVTSTARIQEIDQLSTHFSYCV
SVNATTGTGKLQLGSSSSALSDYFKRVRNNTSKKFIVGFGISSAEHVKNILPQSDGVVIG
SALLKAIADAKTPQAVAVSCDAFWKDVCSGALAKN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccacaactggcgaaaaaagcagaatttctttcctgataaagtctaaccaaaag
cttctcatttcctatttgatgcctgagtttcccgttcggggcgctaccgttccggccatg
ttggctttacaaaatgcgggcgcaaacatgatcgagttgggtgttccgcatagcgatccg
ctggccgatgggccggtcatacaaaaagcggcgcaaattgctttggaaaacggtgtgaat
ttaaagcaagtcctaacttttgtgatagaagcgcggcgtgcgggtttaaaaatccctgta
tttttgatgggatattacaatccactgtttgcttatggcattgataaatttttggcggat
gcagtcgcggctggcgtggacggattcattgttcctgatttgccacctgaagaatcgcat
gaatttttggaaaaatgtaagcaaaatcagctggcactgacgtttttaatttctcctgtg
acaagcacagcgcgcattcaagaaatcgatcagctttcaacgcatttttcctattgtgtt
tccgtcaatgcaactacgggcactggcaaattgcagttaggaagtagttcaagcgcgtta
agcgattattttaaaagagttaggaataatacaagcaagaaatttattgttggatttggc
attagttccgccgaacatgttaaaaacatcttgccacaatcagatggagtggtgattggc
tcggcgctgttaaaagccattgcagatgcgaaaacgccgcaagccgttgccgtttcatgt
gacgcgttttggaaagacgtttgttcgggggcattagccaaaaattaa

DBGET integrated database retrieval system