KEGG   Chloroherpeton thalassium: Ctha_2553Help
Entry
Ctha_2553         CDS       T00726                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cts  Chloroherpeton thalassium
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:cts01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cts00020]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:cts00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3068662..3069858)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGTAMKFFQKWGIPVPSYVVIMNPDRLKLLAEANKWMKESKLVVKAHEAIGGRFK
LGLVKVGLNLEEADAAVREMIGKKVGTTVIKQVIIAEQLEHDEEYYLSINSHRQGTDLLL
SKYGGIDVEENWDKVQRITFDVDEQPTKEQLIQLAHDAGFEGEIAERVAKIASRLVLCHE
NEDAQNIEINPLVIRKSDMRFAALDAVMNVDWDARFRHPDWDFKPTSEIGRPYTDAELQI
MDIDSRIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPPDWAV
EALTETICALPNIKHIIVGGAIANFTDVKATFNGIINGFRDSKDRGLLKDVKIWVRRGGP
NEAAGLEMMRALREEGFDINVYDRTMPMTDIVDMALSS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattcttgaaggaacggcaatgaaatttttccagaaatggggaattccagtg
ccatcctacgtggtaattatgaaccccgataggctcaagctccttgccgaagcaaacaaa
tggatgaaagagtccaaacttgtggtgaaggcgcatgaagctatcggaggtcgttttaag
ctcggtttggtaaaagtcgggctgaaccttgaggaggctgatgcagcagttcgtgagatg
atcggcaaaaaagttggcacaacagtcattaagcaggtcattatcgccgaacagcttgag
catgatgaagagtattacctatcaattaattctcatcgtcaaggaacggatttgcttttg
agcaaatacggcggcattgatgtagaggaaaactgggataaggtacaacgaatcacattc
gatgttgacgaacagccaaccaaagaacaattgattcagcttgcgcatgatgcagggttt
gaaggtgaaattgctgagcgtgtggctaaaatcgccagccgtttggtgctttgccatgaa
aacgaagatgcgcaaaacattgagattaacccattggtcattcgcaaaagcgacatgcgt
tttgctgcattggatgcagtaatgaacgttgattgggacgcccggttccgtcatcccgat
tgggatttcaagccaacctctgaaattggccgtccctacaccgatgctgagttgcaaatt
atggatattgactcccgcattaaaggttcagtgaagtttgttgaagttccaggcggtgaa
atagccctgctcacggcaggtggaggcgcttccgtattttattcagatgctgtggttgca
agagggggcactattgccaactacgctgaatattcgggtgatccaccagattgggctgtt
gaagcgcttacggaaaccatctgtgcgttgccaaatattaaacatattattgtcggcggc
gcgattgcaaacttcaccgatgttaaagccacatttaacggtatcattaatggctttaga
gatagtaaagaccgtggtctattgaaagatgtcaagatttgggtgcgccgcggcggacca
aatgaagccgcaggtttggaaatgatgcgtgctttgcgtgaagaaggatttgacatcaat
gtctatgaccgtactatgccgatgacagatatcgttgacatggcattgagctcgtaa

DBGET integrated database retrieval system