KEGG   Comamonas testosteroni: CtCNB1_0143Help
Entry
CtCNB1_0143       CDS       T01109                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ctt  Comamonas testosteroni
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162513..163421
Genome map
AA seq 302 aa AA seqDB search
MNAADGLGLLQQPDLQQLCVTPHEFVMPGEGRNARTGVLLIHGLTGTPAEMRLLAKGLNK
QGFTVYGVQLAGHCGSMEDLVAARWTDWLASVESGLQRFSLHVDHVVVGGLSMGALLSLA
VAERHPDKVAGVCALSTTFRYDGWSIPAYTKLAFLLPLFRLLGIGRNSVFMEAPPYGIKD
EALRARVVEQMNSGDSSAAGLPGNPWWSVIELRALSANVQAGLAQLRSPCLVIHAREDDI
SSVSNAHDIQRGAVNAHVDLVLLDNCYHMITIDRERRTVIAKLNEFIARIASSAAPARGA
NG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggccgatggattggggctgctgcagcagccggatttgcagcagctgtgcgtg
acgccgcatgagttcgtcatgcccggcgaaggccgcaatgcccgcacgggcgtgctgttg
atccatggcctgaccggcacgcccgccgagatgcgcctgctcgctaaaggtctgaacaag
cagggcttcacggtctacggggtgcagctggcaggacattgcggcagcatggaagacttg
gtggctgcccgctggacggactggctggcaagtgtggagtcgggcctgcagcgcttttcg
ctgcatgtggaccatgtggtggtcggcggtctttccatgggggcgctgctgtcgctggcc
gtggccgagcgccatcccgacaaggttgcgggcgtctgcgcgctgtccaccaccttccgc
tatgacggctggagcatccctgcctataccaagctggcgttcctgctgccgctattccgc
ctgctgggcattggccgcaacagcgtcttcatggaggcgccaccctacggcatcaaggac
gaggccttgcgcgcgcgcgtggtcgagcagatgaacagcggcgacagctctgccgcaggc
ctgcccggcaatccctggtggagcgtcatcgagctgcgcgccctgtccgcgaatgtgcag
gccggactggctcagctgcgctcgccctgtctggtcattcacgcccgggaagacgatatt
tcctcggtcagcaatgcccacgatatccagcgcggcgcggtcaacgcccatgtcgacctg
gtgctgctggacaattgctatcacatgatcaccatcgaccgcgagcgccgcaccgtgatt
gccaagctcaacgagttcatcgcgcgcatcgccagctcggcagcgcctgccaggggtgcg
aatgggtag

DBGET integrated database retrieval system