KEGG   Comamonas testosteroni: CtCNB1_0366Help
Entry
CtCNB1_0366       CDS       T01109                                 

Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CtCNB1_0366
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CtCNB1_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405634..407724
Genome map
AA seq 696 aa AA seqDB search
MKGRRKADLQTLDLFAAPADGDTIAPGTTDWLAALERLADAGLLRRLDSALAAFVAAQDA
EAGPALLVATAVLAQMEGRGHSCLPLKALAGDPNQILAWPKEAERLQQSLWEQLPGRLAD
WLQALRRSPVVRVVQPGAPAADRGQPLVLLDGAAPLLYLRRYWDYERSVAAHIAQRTAAD
AVALDEPRVREWLGRLFSSSAAAANAVDWQKLACALALRGHMSVITGGPGTGKTYTAARL
LALLFATAPDAAQLRVALAAPTGKAAARLKQSIDSSLLELKEAVGRELDLEALVKRMGAA
RTLHSLLRARPDTRRFAHHAGNPLDVDVLIVDEASMIHLEMMAALLQALPPTARLILLGD
KDQLASVEAGAVLGDLCRDAQRGNYAPDTAAYVERVTGQSLPAQYLAPARALPLAQHTVM
LRESRRFGGPIGLLAQAVNAGDAPSAMALLRTQTQAGLHAELWAREGGEVEAVVRSAVQG
RGGMASYAAYAEVLAQHGQGKGCGFATEAEHRQWVREVLAAFDRYRLLCAVRDGSWGVAG
LNRAVEQALQAMGAIRKEGEWYMGRPVMVTRNDAQLGVFNGDIGMALPSFADPARLRVYF
MQGELLHHVSTARLAHVETAFAMTVHKSQGSEFEHTALVLAAQGGNVLSRELVYTGITRA
RKAFSLWTEVPGLLVSAMGSPTQRSSGLLGFMERAQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcgccgcaaagccgatctgcagacgctggacctgtttgcagcccccgcggat
ggcgacacgattgcaccgggcaccacggactggctggccgcgctggagcgattggccgat
gcgggtctgctgcgccgcctggacagcgccctggcggcctttgtagcagcgcaggacgca
gaggcaggacctgcgctgctggtagccaccgccgtgctggcgcagatggaggggcgcggt
catagctgtctgcccttgaaggcgctggctggcgatcccaatcagattctcgcctggccc
aaggaggccgagcgactgcagcaatcgctatgggagcaattgcccggccggctggctgac
tggctgcaggccctgcgtcgcagccctgtggtgcgtgtcgtgcagccaggagcaccagcg
gctgaccgaggccagccgctggtgctcctggacggcgctgcgcccttgctgtatctgcgc
cgctattgggactacgagcgcagtgtcgccgcccatatcgcccagcgcacggcggccgat
gcggtggcgcttgacgagcccagggtgcgcgaatggctggggcggcttttcagctcgtct
gccgctgccgcaaatgcggtggactggcaaaagctggcttgcgcgctggcgctgcggggg
catatgtccgtcatcaccggcgggccgggcacgggcaagacctatactgctgcccgcctg
ctggcgctgctgtttgccacggcgccggatgccgcgcagctgcgcgtcgcgctggctgcg
ccaaccggcaaggcggcggcgcggctcaagcagtccatcgatagctcgctgctggagctg
aaggaggccgtgggccgagagctggatctggaagcgctggtcaaacgcatgggggcggca
cgcaccctgcattcgctgctgagggccaggcctgacacgcggcgctttgcccaccatgca
ggcaatccgctggatgtcgacgtgctcatcgtcgatgaggcctccatgatccacctcgag
atgatggccgcgctgctgcaggccctgccgcccacagcgcgcctgattctgctgggcgac
aaggatcagctcgcctcggtggaggccggtgccgtgctgggcgatctgtgccgcgatgcg
cagcggggcaattacgcgccggacaccgctgcctatgtcgagcgtgtgacgggccagtcc
ctgcctgcacagtacctggcgccggccagggccctgccgctggcccagcacaccgtcatg
ctgcgcgagagccgccgctttggcggccctatcggtctgctggcacaggccgtgaatgcc
ggcgatgcaccttctgccatggcgctgctgcgcacgcagacccaggccggcctgcatgcc
gaactctgggcgcgcgaaggcggtgaggtcgaggccgtggtgcgcagcgccgtgcaaggc
cgtggcggaatggccagctatgccgcctatgccgaggtgctggcacaacatgggcagggc
aagggatgcggctttgccaccgaggccgagcaccggcaatgggtgagggaggtgttggcc
gccttcgaccgctaccgcctgctgtgcgccgtgcgcgacggcagctggggcgtggcgggc
ctgaaccgcgcggtggagcaggccttgcaggccatgggcgccatacgcaaggagggcgag
tggtatatgggtcgtccggtaatggtcacgcgcaacgatgcgcagctgggcgtgttcaac
ggcgatatcggcatggccctgcccagctttgccgacccggcgcggctgcgcgtgtacttc
atgcagggcgagctgctgcaccatgtcagcacggcgcgcctggcccatgtggagaccgca
tttgccatgacggtgcacaagagccagggctcggagttcgagcatacggcgctggtgctg
gccgcgcagggcggcaatgtgctcagccgcgagctggtctataccggcatcacgcgggcg
cgcaaggcgttctcgctgtggaccgaagtgcccggcctgctggtgtcggcgatgggcagt
cccacgcagcgcagcagcggtttgctgggattcatggaacgtgctcagtag

DBGET integrated database retrieval system