KEGG   Comamonas testosteroni: CtCNB1_0515Help
Entry
CtCNB1_0515       CDS       T01109                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ctt  Comamonas testosteroni
Brite
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CtCNB1_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566010..567353
Genome map
AA seq 447 aa AA seqDB search
MRNFRFPTRITLSLVALGCGLLLGACSEGNETPASKEVGKVDKTTAAPALSAVAQVGKKL
FFDKALSASGAMSCASCHDPAHAYGPPNALAVQLGGAHLDKPGLRAVPSLRYKLVTPAYS
NELFDPDGTEPPGPGGGFSWDGRANTLAEQAAQPLLSDFEMGNISREAVVEKVRAASYAP
LFLEVFGSRAFEDGVKAFAGITQALEAFQKEDPDFRPYSSKFDAYVMRGKGTLTVPEQRG
KAVFYDPRRGNCASCHIPDLNQFTDQMYAAIGVPRNPAILANAADKFYDLGLCGPLREDM
KPERSLCGMFKTPTLRNVATRSVFFHNGVMTSLEQVIRFYNTRDTNPEIWYPTKGGKPQT
KPSSDFPTYGLITTQYAGGRVQKFNDLPTAYLENIDPQMPLDGRAAASKPPMSEQDIADL
ICFLKTLTDGFDEAADKKQPASGACVN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattttcgtttccccacacgcatcaccctgtcgcttgtggcattggggtgtggt
ttgttactgggggcttgcagcgaaggcaatgagacgcccgcaagcaaggaagttggcaag
gtggacaagaccactgccgctcccgccttgagtgccgtggcacaggttgggaaaaaactg
ttttttgataaggccctgtcggcctctggcgcgatgtcatgtgcaagctgccatgacccg
gcgcatgcgtatggcccacccaatgccttggcagtacagcttggcggagcccatctggac
aagccaggtctgcgcgccgtgccttcgctgcgttacaaactggtcacgccggcatattca
aacgagctgtttgaccccgatggaacggagccccccggccctggcggcggtttcagctgg
gatgggcgggccaacacgctggccgagcaggctgcgcagcctttgctcagcgatttcgag
atgggcaatatctcgcgtgaagccgtggtggaaaaggttcgcgcagccagttatgcgcca
ctgttcctcgaagtcttcggcagccgggcttttgaagatggtgtgaaggcctttgccggt
attacgcaggctttggaagcctttcagaaggaggatccggatttcaggccgtactccagc
aagttcgatgcttatgtcatgcgtggcaagggcacgctgacggtgccggagcagcggggc
aaggccgtgttctacgacccgcgccgaggcaattgcgcatcctgccatattccggatctg
aatcagttcaccgaccagatgtatgccgctattggtgtgccgcgcaatcccgccattttg
gccaatgcggcagacaagttctatgacctgggactgtgcgggccgctgcgcgaggatatg
aagccggagcgttctttgtgcggcatgttcaagacgcccacgctgcgcaatgtggcaacg
cgcagcgtgtttttccataacggagtcatgacgtcgctggagcaggtcatccgcttctac
aacacgcgcgatacaaatcccgagatctggtatccaacgaaaggcgggaagccacagacg
aagccttcttcggacttcccaacgtatgggttgattaccacgcagtacgcgggaggcagg
gtacagaagttcaatgatctgcccacggcctacctggaaaatattgacccgcaaatgcca
ctggatgggcgcgctgcagcgtcaaagccgcctatgagcgaacaggacattgccgatttg
atctgttttctcaagacactgacagatggctttgatgaggctgcggacaagaaacagcct
gcctcgggggcttgtgtgaattga

DBGET integrated database retrieval system