KEGG   Comamonas testosteroni: CtCNB1_0650Help
Entry
CtCNB1_0650       CDS       T01109                                 

Definition
nicotinate phosphoribosyltransferase
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
ctt  Comamonas testosteroni
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ctt00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735022..736272)
Genome map
AA seq 416 aa AA seqDB search
MDKALAAHIFEKKNGMKPIITSLLDTDLYKFTMWQAMLHRHPQTEAEYEFVCRTPTAFPL
AELLPEVERELDALCSLRFDKGELDYLAGLRFMKSDFIDFLRIFQFQRAFIRAWAEGDRL
HIVAKGPQVHVMGFEIYVLAIVNELYFRRFDADAALVEGRKRLQVKLAQLKHLAVEARLH
NPFELFDFGVRRRFSGAWQREVVQAFAQETAQWFKGTSNVLLARDLNLVPIGTMAHEYLQ
TYQALGVRLRDFQVAALEDWVQEYRGDLGIALTDTVGMDAFLADFDMYFAKLFDDLRHDS
GDPFEWGEKAIAHYEKLRIAPQSKRLVFSDGLDLDTALALYHRFADRIQCGFGIGTRLTN
DMGLTTINIVMKLTHANGQPVAKISDSPGKTLCNDETYLAYLRQVFNIPEPAAKAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggataaagcgctagcagctcatatttttgaaaagaagaacggcatgaagcccatcatc
accagcctgctggacaccgacctctacaaattcacgatgtggcaggccatgctgcaccgc
cacccccagaccgaggccgagtacgaatttgtctgccgcacgcccacggccttcccgctg
gccgagctgctgcccgaggtggagcgcgagctggacgccctgtgcagcctgcgtttcgac
aagggcgagctggactacctggccggcctgcgcttcatgaagagcgacttcatcgacttt
ctgcgcatcttccagttccagcgtgccttcatccgcgcctgggccgaaggcgaccggctc
catatcgtggccaagggcccgcaagtccatgtgatgggcttcgagatctatgtgctggcc
atcgtcaacgagctgtacttccgccgcttcgatgccgatgccgcccttgtcgaaggccgc
aagcgcctgcaggtcaagctggcccagctcaagcatctggctgtcgaggccaggctgcac
aaccccttcgagctgttcgacttcggcgtgcgccgccgcttctcgggagcctggcaacgc
gaggtggtacaggcttttgcccaggagaccgcgcagtggttcaagggcacgtccaacgtg
ctgctggctcgcgacctgaacctggtgcccattggcaccatggcccatgagtatctgcag
acctatcaggccctgggcgtgcgcctgcgcgacttccaggtggccgccctcgaggactgg
gtgcaggaataccgcggcgacctgggtatcgccctgaccgataccgtgggcatggacgcc
tttctggccgacttcgacatgtactttgccaagctcttcgacgacctgcgccatgactcc
ggcgatcccttcgagtggggcgagaaggccattgcccactatgaaaagctgcgcattgcg
ccgcagagcaagcgcctggtgttctcggacggactcgatctggacacggcactggcgctc
taccaccgctttgccgatcgcatccagtgcggcttcggcataggcacgcgattgaccaat
gacatgggactgaccacgatcaatatcgtgatgaagctgacccatgccaacggccagccc
gtggccaagatttcggactcgcccggcaagacgctgtgcaacgacgagacctatctggcc
tatctgcgccaggtcttcaacattcctgagcctgctgccaaggccgcctga

DBGET integrated database retrieval system