KEGG   Comamonas testosteroni CNB-2: CtCNB1_0712Help
Entry
CtCNB1_0712       CDS       T01109                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CtCNB1_0712
  Amino acid metabolism
   00340 Histidine metabolism
    CtCNB1_0712
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CtCNB1_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
804773..806089
Genome map
AA seq 438 aa AA seqDB search
MEFVAAPARLSTADAQFEHDFAQRLHWSADTDAAIEQRVADILADVQQRGDAAVLEYTAR
FDGLQADSMAALELTKQELKDAFDSLPAAEREALESAARRVRSYHEAQKKANGESWSYRD
EDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVQDIIMVVPTPQGQKNPL
VLAAAYVAGVHRAFTIGGAQAVAALAYGTATVPKVDKITGPGNAYVASAKKRVFGIVGID
MIAGPSEILVLADGTTPPDWVAMDLFSQAEHDELAQSILLCPDAAYIDAVQAAIDRLLPE
MPRRAIIAKSLSDRGALILTKDMEEACAISNRIAPEHLEVSSRDPHRWEPLLRHAGAIFL
GAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIEVSEAGAQVLGKTAAVL
AYGEGLQGHARAAEMRLK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgtagctgcccccgcccgtctgtcaaccgctgatgcccagttcgagcatgat
tttgcgcagcgtctgcattggtcggcggacacggatgcagccatcgagcagcgggtggcc
gacatcctggccgatgttcagcagcgcggcgacgccgccgtgcttgaatacacggcacgc
tttgacggcctgcaggccgattccatggcggcgctggagctgaccaagcaggagctgaaa
gacgccttcgacagcctgccagccgccgagcgcgaagcgctggagtcggcggcacgccgt
gtgcgcagctatcacgaggcgcagaaaaaggccaatggcgagagctggagctaccgcgac
gaagacggcacgctgctgggccagaaggtcacgccgctggaccgcgtgggcatctacgtg
ccgggcggcaaggccgcctatccgtccagcgtgctgatgaacgccattcccgcccatgta
gccggtgtgcaggacatcatcatggtcgtgcccacgccccagggtcagaagaacccgctg
gtgttggccgcggcctatgtggctggcgtgcaccgcgccttcaccatcggtggcgcccag
gccgtggctgccctggcctacggaacggccaccgtgcccaaggtggacaagatcaccggc
cccggcaatgcctatgtggccagcgccaagaagcgcgtgttcggcatcgtgggcatcgac
atgattgccggtccttctgaaatcctggtgctggccgacggaacgaccccgcccgactgg
gtggccatggatctgttcagccaggccgaacacgacgagctggcccagtccatcctgctg
tgtcccgatgcagcctatatcgatgccgtccaggccgcgatcgaccgcctgctgcccgag
atgccgcgcagggccatcatcgccaagagcctgagcgaccgcggtgcactgattctgacc
aaggacatggaagaggcttgcgcgatcagcaatcgcatcgcgcccgagcacctggaagtc
tccagccgtgacccgcaccgctgggagcctttgctcaggcacgccggtgccatcttcctg
ggcgcctatacctccgagagcctgggcgactactgcgccggcccgaatcacgtgctgccg
accagtggcacggcgcgcttttcctcgccgctgggggtgtacgacttccagaagcgcagc
tccatcatcgaagtcagcgaggccggtgcccaggtcctgggcaagaccgcagccgtgctg
gcctatggtgaaggcctgcagggccatgccagggctgccgaaatgcgcctgaagtaa

DBGET integrated database retrieval system