KEGG   Comamonas testosteroni: CtCNB1_0719Help
Entry
CtCNB1_0719       CDS       T01109                                 

Definition
imidazole glycerol phosphate synthase
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
ctt  Comamonas testosteroni
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ctt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
811466..812134
Genome map
AA seq 222 aa AA seqDB search
MSLKNNTVAVVDYGMGNLRSVSQAVRTAAADTGWDVVVTADPDVVHAANRVVLPGQGAMP
DCMRELRESGLQQAVLDAAANKPLFGVCVGMQMLLDHSDEGDVPGLGLIPGNVRKFDLEG
RMQADGSRFKVPQMGWNQVQQTQQGGKPHALWAGIPDGSFYYFVHSFYAQVQHSAHCAAE
TDYGGLFACAVARDNIFATQFHPEKSSDQGLALFRNFLGWKP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaagaacaacaccgtggccgtggtcgattacggcatgggcaatctgcgttcg
gtctcgcaggcggtgcgcacggccgcagccgataccggctgggacgtggtcgtcacggcc
gatcccgatgtggtccatgccgccaaccgcgtggtcctgcccggtcagggggccatgccc
gactgcatgcgcgagctgcgcgaatcgggcctgcagcaggccgtgctcgatgcggctgcc
aacaagccgctgttcggcgtctgcgtgggcatgcagatgctgctcgaccacagcgacgaa
ggcgatgtgccgggcctgggactgattcccggcaatgtgcgcaagttcgatctcgaaggc
cgaatgcaggccgatggcagccgtttcaaggtgccgcaaatgggctggaaccaggtgcag
cagacgcagcagggcggcaagccccatgcgctgtgggccggcattccagacggcagcttc
tactactttgtgcacagcttttatgcgcaggtgcaacacagcgcgcattgcgcggccgag
accgactatggcggcctctttgcatgtgccgtcgcacgcgataatattttcgcaacccag
ttccaccccgagaaaagctcggaccagggactggcgctgttccgcaacttcctgggctgg
aagccctga

DBGET integrated database retrieval system