KEGG   Comamonas testosteroni: CtCNB1_0721Help
Entry
CtCNB1_0721       CDS       T01109                                 

Definition
Aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ctt  Comamonas testosteroni
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctt00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812929..813795
Genome map
AA seq 288 aa AA seqDB search
MSDLTFQAQAVDWKGLPAIALKLGQGDSVLISLQGAQVLSWVGRGQERLFLSPRASHDGK
SAIRGGIPVCFPQFNQRGPLVKHGFARISHWQADAAQPSGEDGAQISLRLTDSEASRAVW
PHAFEAVLTVELRPGALRVELAVHNRGRQDLSFTAALHGYLRVAQAEQASLHGLEGLSYW
DAAAAQPDTHVTQQGCVSFGAETDRVYPRAAAALQLQGSGRPWLQLAQDASWSETVVWNP
GPALCATLKDMEADSWQQMLCVEAAAIDAPVVLGPDQRWKAAQTFECF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatttgacgtttcaggcccaggccgttgactggaaagggcttcctgccattgcc
ttgaagctgggtcagggagattcggtgctgatcagcctgcagggcgcccaggtactgtcc
tgggtcggccgggggcaggagcgcctgttcctcagtccccgcgcatctcatgacggcaag
agcgccattcgcggcggcattccggtctgctttccgcagttcaatcagcgtggtcccttg
gtcaagcatggctttgcgcgcatcagccactggcaggccgatgctgcgcagccatcgggc
gaggatggtgcgcagatctccttgcgcctgacggacagcgaagcatcgcgcgccgtctgg
ccgcacgcctttgaggccgtgctcacggtcgagctcaggcccggcgcgttgcgtgtggaa
ctggccgtgcataaccgcggccggcaggacctgtcttttaccgcggctttgcacggctat
cttcgcgttgcgcaggccgagcaggccagcttgcacggtctcgaaggtttgagctactgg
gatgctgctgcggctcagccggacacccatgtcacgcagcaaggctgcgtcagcttcggt
gcggagaccgatcgcgtctatccacgtgcggctgcagccctgcaactgcaaggctcgggc
cgcccctggctgcagcttgcccaggatgcatcctggagcgaaaccgtggtctggaacccc
ggccccgcactgtgcgccacgctcaaggacatggaggccgacagctggcagcaaatgctg
tgtgtggaggctgcggccattgatgctcctgtggttcttggacccgaccagcgctggaag
gcggcgcaaaccttcgaatgcttttga

DBGET integrated database retrieval system