KEGG   Comamonas testosteroni CNB-2: CtCNB1_0815Help
Entry
CtCNB1_0815       CDS       T01109                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00900  Terpenoid backbone biosynthesis
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CtCNB1_0815
Enzymes [BR:ctt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CtCNB1_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACY31561
UniProt: D0J094
Position
complement(913283..914146)
Genome map
AA seq 287 aa AA seqDB search
MHSLYDVPAPAKLNLFLHITGRRPDGYHLLESVFMLIDWHDVLHLERTVSSQISREDLNG
VALPADDLITRAARALQQATGCTQGVRIGIEKHLPAQAGMGGGSSDAASTLMALNRLWNL
KLSRQELQDIGLKLGADVPFFLCGHSAWVSGIGEIITPLTGRNALPEQQFLVVKPEQGLE
TGKIFSSELLKRDTKPAIVADFAANHFGFGRNDLQPVAEGLQPEVMKVRSWLESLKLHAT
MTGSGSAVFAPITQSIDLSCAPGTWQIKVCRNLEKHPLNSWIPENKL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgctctatgacgtgccggccccggccaagctcaacctttttttgcatattacc
ggccgcaggcctgacggctatcacctgctggaatccgtcttcatgctcatcgactggcat
gatgtgctgcatctcgagcgcacggtcagcagccagatcagccgtgaagacctcaacggc
gttgccctgcctgccgatgatctgatcacacgcgcggcccgtgccctgcagcaagccaca
ggctgcacgcaaggcgtgcgcatagggattgaaaagcacctgcccgcccaagccggcatg
gggggcggctcatccgatgcggccagcacgctgatggcattgaaccgcctctggaatctg
aagctctcacgccaggaactgcaagacataggcttgaagctcggcgccgatgtccccttt
ttcctctgcggtcactcggcctgggtcagcggcatcggcgaaatcatcaccccgctgaca
ggccgcaatgccttgccggagcagcagttcctggtggtcaagcccgaacagggcctggaa
acgggcaagattttttccagcgagctcctgaaacgcgacacaaagcctgctatagttgcg
gacttcgctgcgaatcacttcggctttggccgaaacgacctgcagccggtcgctgaaggc
ttgcagcccgaggtgatgaaagtcagaagctggctcgaatcactcaaattgcatgctaca
atgacgggctctggaagtgcggtatttgcaccgataacgcaaagcattgatttgagctgt
gctcctggcacatggcagatcaaagtttgcagaaatctggaaaaacacccacttaatagc
tggattccagagaacaagttataa

DBGET integrated database retrieval system