KEGG   Comamonas testosteroni: CtCNB1_0818Help
Entry
CtCNB1_0818       CDS       T01109                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ctt  Comamonas testosteroni
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ctt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916562..917401
Genome map
AA seq 279 aa AA seqDB search
MPELPEVEVTRRSFADRIAGAQIEKATLGKPLRWPLGLLPQALVGRVVLGVRRRGKYLLL
DLSEGLLLMHLGMSGSLRFAGRDEEPLGTGGAHDHFDLQTSRGLLRLHDPRRFGAVIYVP
DEGDVLARKLLDHLGMEPLSDGFTLDAFQAGLAASRSPIKQLLLSGSVVVGVGNIYASEV
LFLSRIHPTTPARDVGRRKVKVLYEAIRSVLALAVEKGGTTLRDFSAANGMEGHFQLEAQ
VYGRDGLPCSHCGAAIQLMRQGQRSTYYCARCQKAAKTL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgcccgaagtcgaggttacgcgccgctcttttgctgaccgcattgcgggt
gcgcagattgagaaagccaccttgggaaagcccctgcgctggcctctggggctgttgccg
caggcactggtcggcagagtcgtgctgggcgtgcgcagacgcggcaagtatctgctgctg
gacctgagcgagggtctgctgctcatgcaccttggcatgtctggcagtctgcgctttgcg
ggccgcgacgaggagccgctgggtactggcggagcgcatgatcacttcgacctgcagaca
tcgcgcggcttgctgcgtctgcatgacccgcgccgcttcggagccgtgatctatgttccg
gatgaaggcgatgtcctggcgcgcaagctgcttgaccatctgggtatggagccgctgagc
gacggattcacgctggacgcctttcaggccgggctggctgccagtcgctcgcccatcaag
cagctgctgctcagcggcagcgtggtcgtcggtgtcggcaatatctatgcttccgaggtg
ttgtttctctcgcggattcacccgacaacaccggcgcgcgatgtgggcaggcgcaaggtc
aaggttttgtatgaggccattcgctccgtgctggccttggcggtggagaaaggcggcacg
accttgcgcgatttttccgcggccaacggcatggaagggcactttcagctggaggcccag
gtttatggccgcgatggcctgccttgctcgcattgcggcgccgccatccagctcatgcgc
caggggcagcgcagcacctattactgcgcccgctgccagaaggccgcgaaaactctctga

DBGET integrated database retrieval system