KEGG   Comamonas testosteroni CNB-2: CtCNB1_0986Help
Entry
CtCNB1_0986       CDS       T01109                                 

Definition
glycoside hydrolase, family 3-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CtCNB1_0986
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CtCNB1_0986
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CtCNB1_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112005..1113099
Genome map
AA seq 364 aa AA seqDB search
MSMHAPLIIDIAGTSLTDVDRARLAHPLVGGIILFKRNWEDRSALVQLCADIKAVKPDLL
ISVDHEGGRVQRFRTDGFTHLPPMRAFGEMWMDDGGKGRKYREGSGAMRAMNAATAAGYV
LGTELRACGVDFSFTPVLDLDYGESSVIGDRSFHRDPRVVATLARSLMQGLLQAGMGNCG
KHFPGHGFVKADSHVDIPVDKRSLTAILDEDAAPYPWLSSVLTAVMPAHVIYPKVDKRPA
GFSGKWLKDILRARLRYDGAIFSDDLSMEGARRIDGALISYTDAALTALNAGCDMVLLCN
QSLGLGEHVDELLDGMDAALRDGRWVPDIDSESRRVSLLPDTEPQAWDDLMRQPAYLQAL
DLLP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcatgcacctctgatcattgatattgccggcacatcgctgactgatgtggac
cgcgcgcgcctggcccatcctctggtgggcggcatcattctcttcaagcgcaactgggag
gaccgcagcgcgctggtccagctgtgcgccgatatcaaggccgtcaagcccgacctgctg
atcagcgtggaccacgaaggcggccgcgtgcagcgctttcgcaccgatggcttcacgcat
ctaccgccgatgcgcgcctttggcgagatgtggatggatgatggcggcaagggccgaaaa
taccgcgaaggcagcggcgccatgcgggccatgaacgccgccacggccgccggctatgtg
ctgggcacggagctgcgtgcctgcggtgtggatttcagcttcacgcccgtgctggatctg
gactatggcgagtcctcggtcatcggtgaccgcagctttcaccgcgacccgcgcgtggtg
gccacactggccaggagcctgatgcagggtctgctgcaggccggcatgggcaactgcggc
aagcattttcccggtcacggctttgtgaaggccgactcgcatgtggacattcccgtcgac
aagcgcagcctgacggccatcctcgacgaagacgccgctccctatccctggctgtccagc
gtgctcacggccgtcatgcccgcccatgtgatctatcccaaggtggacaagcgcccggca
ggcttcagcggaaaatggctcaaggacatcctgcgcgcccgcttgcgctatgacggagcc
atcttcagcgatgacctcagcatggagggcgcgcgccgcatcgatggcgcactcatcagc
tacaccgatgccgcgttgacggccctgaatgcgggctgcgacatggtgctgctgtgcaac
cagagcctgggtctgggcgagcatgtggacgagctgctggacggcatggatgccgcgctg
cgcgatggccgctgggtgcccgatatcgactccgaatcgcgccgtgtctcgctgctgccc
gacaccgaaccccaggcctgggacgacctgatgcgccagcctgcctatctgcaggcgctg
gatctgctgccctag

DBGET integrated database retrieval system