KEGG   Comamonas testosteroni CNB-2: CtCNB1_0988Help
Entry
CtCNB1_0988       CDS       T01109                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_0988
   01230 Biosynthesis of amino acids
    CtCNB1_0988
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_0988
   00030 Pentose phosphate pathway
    CtCNB1_0988
   00051 Fructose and mannose metabolism
    CtCNB1_0988
   00052 Galactose metabolism
    CtCNB1_0988
  Energy metabolism
   00680 Methane metabolism
    CtCNB1_0988
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CtCNB1_0988
Enzymes [BR:ctt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CtCNB1_0988
Protein phosphatases and associated proteins [BR:ctt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CtCNB1_0988
Messenger RNA biogenesis [BR:ctt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CtCNB1_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115186..1116241
Genome map
AA seq 351 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLINHGQCEVLGIADGFEGLMDASPRVRALSWDEVS
GILHIGGTILGTSNSANPLRDAATLAQVGRNVKALALDVVVAIGGDGTMSLAHGLAQVGL
QCVGVPKTIDNDIANCERSFGFDTAVATVTESLRRIESTAMSHHRVMIVETMGRHAGWLA
LESGIAGAADIILLPEIDYDLQSIIKVCQERERRQRYTIICIGEGAKESGQSLTVRERIA
HSPDPVRLGGVGHVLRERLQPHLQSEVRTTVLGHVQRGGDPTPFDRVLATQFGHHAAQLV
LGGQLGHMVTLQNGRIGSVAIADVANTQRTVPLDSPLLTMARDIGICFGEA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttggtgtgctgaccggtggcggcgactgccccggcctcaatgcggtgatccgt
gcggtcaccaagtccctgatcaaccatggccagtgcgaggtactgggcattgccgacggc
tttgaagggttgatggatgccagtccgcgcgtcagagcgctgagctgggacgaggtcagc
ggcattctgcatatcggcggcaccatcctgggcaccagcaacagcgccaacccgctgcgc
gatgcggccacgctggcccaggtggggcgcaatgtcaaggcgctggcactggatgtggtg
gtcgccatcggcggcgacggcaccatgagtctggcccatggcctggcgcaggtgggactg
caatgcgtgggcgtgcccaagaccatcgataacgacattgccaactgcgagcgcagcttc
ggcttcgacacggccgtggccacggtgaccgaaagcctgcgccgcatcgagagcacggcc
atgagccaccaccgcgtgatgatcgtggagaccatgggccgccatgcgggctggctggca
ctggagtccggcatcgccggtgctgccgacatcattttgctgcccgagatcgattacgac
ctgcagtccatcatcaaggtctgtcaggagcgcgagcggcgtcagcgctacaccatcatc
tgcatcggcgagggggccaaggaaagcggccagagcctgacggtgcgcgagcggattgcg
cacagtcccgaccccgtgcgtctgggcggtgtcggccatgtgctgcgcgagcgcctgcaa
ccccatctccagagcgaggtgcgcaccacggtgctggggcatgtgcagcgcggcggcgat
ccgacgccgtttgaccgggtgctggccacgcagttcggccaccatgctgcgcaactggtg
ctgggcggccagctgggccatatggtcacgctgcagaacggccgcatcggcagtgtggcg
attgccgatgtggccaacacccagcgcaccgtgccgttggacagcccgctgctgaccatg
gcgcgcgatatcggaatttgctttggcgaggcctga

DBGET integrated database retrieval system