KEGG   Comamonas testosteroni CNB-2: CtCNB1_0988Help
Entry
CtCNB1_0988       CDS       T01109                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00010  Glycolysis / Gluconeogenesis
ctt00030  Pentose phosphate pathway
ctt00051  Fructose and mannose metabolism
ctt00052  Galactose metabolism
ctt00680  Methane metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_0988
   00030 Pentose phosphate pathway
    CtCNB1_0988
   00051 Fructose and mannose metabolism
    CtCNB1_0988
   00052 Galactose metabolism
    CtCNB1_0988
  Energy metabolism
   00680 Methane metabolism
    CtCNB1_0988
Enzymes [BR:ctt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CtCNB1_0988
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CtCNB1_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase DUF1382
Motif
Other DBs
NCBI-ProteinID: ACY31734
UniProt: D0J1I8
Position
1115186..1116241
Genome map
AA seq 351 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLINHGQCEVLGIADGFEGLMDASPRVRALSWDEVS
GILHIGGTILGTSNSANPLRDAATLAQVGRNVKALALDVVVAIGGDGTMSLAHGLAQVGL
QCVGVPKTIDNDIANCERSFGFDTAVATVTESLRRIESTAMSHHRVMIVETMGRHAGWLA
LESGIAGAADIILLPEIDYDLQSIIKVCQERERRQRYTIICIGEGAKESGQSLTVRERIA
HSPDPVRLGGVGHVLRERLQPHLQSEVRTTVLGHVQRGGDPTPFDRVLATQFGHHAAQLV
LGGQLGHMVTLQNGRIGSVAIADVANTQRTVPLDSPLLTMARDIGICFGEA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttggtgtgctgaccggtggcggcgactgccccggcctcaatgcggtgatccgt
gcggtcaccaagtccctgatcaaccatggccagtgcgaggtactgggcattgccgacggc
tttgaagggttgatggatgccagtccgcgcgtcagagcgctgagctgggacgaggtcagc
ggcattctgcatatcggcggcaccatcctgggcaccagcaacagcgccaacccgctgcgc
gatgcggccacgctggcccaggtggggcgcaatgtcaaggcgctggcactggatgtggtg
gtcgccatcggcggcgacggcaccatgagtctggcccatggcctggcgcaggtgggactg
caatgcgtgggcgtgcccaagaccatcgataacgacattgccaactgcgagcgcagcttc
ggcttcgacacggccgtggccacggtgaccgaaagcctgcgccgcatcgagagcacggcc
atgagccaccaccgcgtgatgatcgtggagaccatgggccgccatgcgggctggctggca
ctggagtccggcatcgccggtgctgccgacatcattttgctgcccgagatcgattacgac
ctgcagtccatcatcaaggtctgtcaggagcgcgagcggcgtcagcgctacaccatcatc
tgcatcggcgagggggccaaggaaagcggccagagcctgacggtgcgcgagcggattgcg
cacagtcccgaccccgtgcgtctgggcggtgtcggccatgtgctgcgcgagcgcctgcaa
ccccatctccagagcgaggtgcgcaccacggtgctggggcatgtgcagcgcggcggcgat
ccgacgccgtttgaccgggtgctggccacgcagttcggccaccatgctgcgcaactggtg
ctgggcggccagctgggccatatggtcacgctgcagaacggccgcatcggcagtgtggcg
attgccgatgtggccaacacccagcgcaccgtgccgttggacagcccgctgctgaccatg
gcgcgcgatatcggaatttgctttggcgaggcctga

DBGET integrated database retrieval system