KEGG   Comamonas testosteroni CNB-2: CtCNB1_1000Help
Entry
CtCNB1_1000       CDS       T01109                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00260  Glycine, serine and threonine metabolism
ctt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01130  Biosynthesis of antibiotics
ctt01230  Biosynthesis of amino acids
Module
ctt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CtCNB1_1000
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CtCNB1_1000
Enzymes [BR:ctt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CtCNB1_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACY31746
UniProt: D0J1K0
Position
complement(1126897..1127973)
Genome map
AA seq 358 aa AA seqDB search
MGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQHGVATATICARYG
LECIVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMRDWVANVDNTFYI
IGTVAGPHPYPMMVRDFQKVIGDECLTQMPEFLGADKQPDAVVACVGGGSNAMGIFYPYI
PYENTQLFGVEAAGEGLESGKHSASLQKGSSGVLHGNRTFILQDENGQITETHSVSAGLD
YPGVGPEHAWLQEIGRAQYVGITDQEALDAFHYLCRAEGIIPALESSHAVAYAMKLAKTM
RADQSILVSLSGRGDKDIGTVADLSGAEYFDRPSMRGLTVKGAPGHDAAKAAAGGNKL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgcgcagatctatctgaagcgcgaggacctcaaccacacgggcgcacacaag
atcaacaatgtgatcggccaggccatgctcgccaagcgcatgggcaagccgcgcatcatt
gccgagacaggtgccggtcagcacggcgtggccacggccaccatctgcgctcgttacggc
cttgaatgcatcgtctacatgggcgccgaggacgtgaagcgtcaaagccccaatgtctac
cgcatgaagctgctgggcgccaccgtggtgcccgtggaatcgggctccagaacgctcaag
gatgcgctcaacgaagccatgcgcgactgggtggccaatgtggacaacaccttctacatc
atcggcaccgtggccggcccccatccctatcccatgatggtgcgcgacttccagaaagtc
atcggcgacgagtgcctgacgcagatgcccgagttcctgggcgccgacaagcagcccgac
gcggtagtcgcctgcgtgggcggcggcagcaatgccatgggcatcttctacccctatatc
ccctacgagaacacccagctgttcggcgtggaagcggcgggcgaaggcctggagtccggc
aagcactcggcctcgctgcaaaaaggcagctcgggcgtgctgcacggcaaccgcaccttc
atcctgcaggacgaaaacggccagatcaccgagacccactcggtgagcgccggcctggat
taccccggcgtgggccctgagcatgcatggctgcaggaaatcggccgtgcccagtatgtg
ggcatcaccgatcaggaggcgctggacgccttccactatctgtgccgcgccgaaggcatc
atcccggctctcgagtccagccacgccgtggcctatgccatgaagctggccaagaccatg
cgcgccgaccagtcgattctcgtcagcctatcgggccgtggcgacaaggacatcggcacc
gtcgccgacctctcgggtgccgaatatttcgaccgcccctccatgcgcggtctcaccgtc
aagggcgctcccggacatgatgcagccaaggctgccgcagggggcaacaagttatga

DBGET integrated database retrieval system