KEGG   Comamonas testosteroni: CtCNB1_1060Help
Entry
CtCNB1_1060       CDS       T01109                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctt  Comamonas testosteroni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_1060
   01230 Biosynthesis of amino acids
    CtCNB1_1060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_1060
   00051 Fructose and mannose metabolism
    CtCNB1_1060
   00562 Inositol phosphate metabolism
    CtCNB1_1060
Enzymes [BR:ctt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CtCNB1_1060
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CtCNB1_1060
  Exosomal proteins of bladder cancer cells
   CtCNB1_1060
  Exosomal proteins of melanoma cells
   CtCNB1_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1191544..1192299
Genome map
AA seq 251 aa AA seqDB search
MGNMKQKLIVGNWKMNGSLAANAALLQAIKQGLPAGNKAGVAVAAPAPYLAQVQAELAGT
SIGVGAQDVSQHEQGAFTGETSAVMLKEFGVRYALVGHSERRQYHGETDVVVAAKAQAAL
AKGITPIVCVGETLAEREAGQTEAVVKRQLAAVIHQVGHCVSELVVAYEPVWAIGTGKTA
TPEQAQQVHAVLRAQLAAASDKADRVPLLYGGSMNAGNAAQLLAQADIDGGLIGGAALKA
PDFLTIIAAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaacatgaagcaaaaactcattgttggcaactggaagatgaacggcagcctggct
gccaatgctgctttgctgcaggccatcaagcagggcttgcctgctggcaacaaggcgggc
gtggccgtggctgctcctgcgccctatctggctcaagtccaggcggaacttgcgggtact
tccattggggtgggcgcacaggatgtgtcccagcacgagcagggcgcattcacgggcgaa
acttctgctgtcatgctcaaggagttcggcgtgcgctatgcgctggtcggtcactccgag
cgtcgtcagtatcatggcgagaccgatgtcgtggttgctgccaaggcccaggctgcgctg
gccaagggcatcacgcccatcgtctgcgtgggcgagaccctggcggagcgtgaagcgggt
cagaccgaggccgtggtcaagcgtcagctggcagccgtgattcatcaggtcggccactgc
gtgagcgagctggttgtggcctatgagcctgtctgggccataggcaccggcaagactgcc
actcccgagcaggcccagcaggtgcatgccgtgctgcgggcgcagctggcggcggccagc
gacaaggctgatcgcgtgcccctgctttatggcggcagcatgaatgcaggcaatgcggcg
cagctgctggctcaggccgatattgacggtggcctgatcggtggtgcggctctcaaggcc
ccggatttcctcaccattattgcggcagcgcaataa

DBGET integrated database retrieval system