KEGG   Comamonas testosteroni CNB-2: CtCNB1_1291Help
Entry
CtCNB1_1291       CDS       T01109                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CtCNB1_1291
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_1291
   00640 Propanoate metabolism
    CtCNB1_1291
   00650 Butanoate metabolism
    CtCNB1_1291
  Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_1291
   00072 Synthesis and degradation of ketone bodies
    CtCNB1_1291
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CtCNB1_1291
   00310 Lysine degradation
    CtCNB1_1291
   00380 Tryptophan metabolism
    CtCNB1_1291
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CtCNB1_1291
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_1291
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_1291
Enzymes [BR:ctt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CtCNB1_1291
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CtCNB1_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1456668..1457939
Genome map
AA seq 423 aa AA seqDB search
MADLDTAAKAAQGATKRKLGDKDMKDAVIVSTARTPIGKAYRGAFNDTEAPVLGGHVIRA
ALNKANVAGADVDDVILGIAAQQGTQGYNLGRLCGYTAGLPESVGGMVIDRMCASGLMSI
ATAAKGVMTGEMNIAVAGGLESISLVQNKYKNSYRAQSKAVLAAEPTAYIQMIETAELVS
QRYGISREAQDEYSLRSQQRVAAAQARGLFDDEIVPLTTVKQLFDKEGNVTGSEEVTLTR
DEGNRADTTLESLAKLKPVWKNGQWVEQGQFITAGNASQLSDGASACVVMSADEARSRGL
APLGIYRGVAVAGCRADEMGIGPVYAIPKLLKQHGLTVGDIGLWEINEAFACQVIYSRDK
LGIPDERLNVNGGAISIGHPFGMSGARLVGHALLEGRRRGVRFVVVSMCIGGGMGAAGLF
ELS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacctcgatacggcagcaaaagctgcccagggcgcgacgaaaagaaagttagga
gacaaagacatgaaagacgcagtcatcgtttcgacggcacgtacccccataggcaaggct
taccgtggtgccttcaacgacaccgaagccccggtgctgggcggacacgtcattcgcgcg
gcgctcaacaaggcgaacgtggccggtgcggatgtggatgacgtcattttgggcattgcc
gcgcagcagggcacgcagggctacaacctggggcgtctgtgcggctataccgccggcctg
ccggaatccgtgggcggaatggtgatcgatcgcatgtgcgcatcgggcctgatgagcatt
gccacggctgccaagggtgtcatgaccggcgagatgaatatcgctgtggccggcggcctg
gagtccatttccctggttcagaacaagtacaagaactcgtaccgcgcccaatcgaaggct
gtgctggccgcagagcccacagcctacatccagatgatagagacggccgagctggtcagc
cagcgttacggcatcagtcgtgaagcccaggacgagtactcgctgcgcagccagcagcgc
gtggccgccgcacaggcccgtggcctgttcgacgatgaaatcgtgccgctgaccacggtc
aagcagctgtttgacaaggaaggcaatgtcaccggcagcgaggaagtcacgctgacccgc
gacgagggcaaccgtgccgacactacgcttgagagtctggccaagctcaagcctgtatgg
aagaacggccagtgggtggagcaaggccagttcatcacggccggcaatgcatcccagctg
tccgacggtgccagcgcctgtgtggtgatgagtgccgacgaagcccgcagtcgcggcctc
gcgcctctgggcatctatcgcggcgtggccgtggcaggttgccgtgccgatgaaatgggg
atcggccccgtctatgccatccccaagctgctcaagcagcatgggctgacggttggcgac
atcggcctgtgggaaatcaacgaggcatttgcctgccaggtgatctacagccgcgacaaa
ctgggcattcccgatgagcgcctgaacgtcaacggcggcgcgatctccatcggccacccc
ttcggcatgtcgggcgcacgtctggttggtcacgccctgctggaggggcgtcgccgcggc
gtgcgttttgtggtggtgagcatgtgtattggcggcggcatgggcgctgccggcctgttt
gagctgagctga

DBGET integrated database retrieval system