KEGG   Comamonas testosteroni CNB-2: CtCNB1_1297Help
Entry
CtCNB1_1297       CDS       T01109                                 

Definition
3-hydroxyacyl-CoA dehydrogenase, NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_1297
   01212 Fatty acid metabolism
    CtCNB1_1297
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CtCNB1_1297
   00650 Butanoate metabolism
    CtCNB1_1297
  Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_1297
   01040 Biosynthesis of unsaturated fatty acids
    CtCNB1_1297
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CtCNB1_1297
   00310 Lysine degradation
    CtCNB1_1297
   00380 Tryptophan metabolism
    CtCNB1_1297
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CtCNB1_1297
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CtCNB1_1297
   00281 Geraniol degradation
    CtCNB1_1297
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CtCNB1_1297
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CtCNB1_1297
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CtCNB1_1297
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CtCNB1_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465077..1467236
Genome map
AA seq 719 aa AA seqDB search
MTTEIILYAVDEDGIATLTLDYPGKTMNVIDQAFMDSLEACIARMHGDDRVRGGIITSGK
DSFVAGADLMGMEANIDAMADMPIEELFDSCASLSRLLRKLETLGKPLVAAINGMALGGG
YEICLACHHRIAADAPTVMVGLPEAQVGLLPGAGGTQRLPRMIGILAAMPFLMEGKQLQA
VKAREAGLVDEVVAPEQLLSAAKAWLLARPTALQPWDVKGFRIPGGGPLDARVAPAFVVG
NTMLQAKTFHNMPAPLCIQSCIYEGCQLPIDKGLRIESKYMATLSRSPVARGMIRTLFVN
KAKAEKGMHRPAGLEPFQCRKLGLIGAGMMGAGIALVAAQRGIQVVLIDRDQAAADKGKQ
YSEKTLARQVDKGRQSREKADAILARITPGTDYELLRDADMVVEAVFEDRAIKAEVTRKL
DAVLPPGCVLASNTSALPISLLAQASDRPDRFIGLHFFSPADKMPLVEVIRGKQTSDATL
AQALDFVAQLKKTPIVVNDKRGFFTSRFIGAFVDDAIGMVAEGIAPALIENCAKHAGMPV
GPLAITDELSIDLSKHAGESQAKEFPEEYKPGRSVPVIGKLFELGRLGRKVGKGFYDYDE
SGKRIWPGLAEHYPLKATQPSAHDLKQRILYVQAVEGARAMEEGVLLAPADGDIGSILGV
GFPVYTGGPFCFIDGIGLAQFVAEADRLADLFGEQLRPPQLLRDMAAKGQTFYGKSARA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggaaatcattctctacgccgtagatgaggacggcattgccacgctgacgctg
gattaccccggcaagaccatgaatgtgatcgaccaggccttcatggacagcctggaagcc
tgtatcgcacgcatgcacggcgacgaccgggtgcgcggcggcatcattacctcgggcaag
gacagctttgtcgcgggggccgacctgatgggcatggaggccaatatcgacgccatggcg
gacatgcccatcgaggaactgttcgactcctgcgcatcgctgtccaggctgctgcgcaaa
ctggagaccctgggcaagccgctggtggcggccatcaacggcatggcattgggcggcggc
tatgaaatctgcctggcctgccaccaccgcattgcagccgatgcccccacggtcatggtc
ggcctgcccgaggctcaagtgggcttgctgcccggcgccggcggcacccagcgtctgccg
cgcatgatcggcattctggccgccatgccttttctcatggagggcaagcagttgcaggca
gtgaaggccagggaagccggtctggtggacgaagtggtggctcccgagcagttgctcagt
gctgccaaggcctggctgctggccaggcccacggcgctgcagccctgggatgtgaaaggc
tttcgcatccccggtggcggcccgctggatgcgcgcgtggctccggccttcgtggtgggc
aacaccatgctgcaggccaagacctttcacaatatgccagcgccgctgtgcattcaaagc
tgcatctacgaaggttgccagctgcccatcgacaagggcctgcgcatcgagagcaagtac
atggccacgctgtcgcgcagtcccgtggcgcgcggcatgattcgcaccctcttcgtcaac
aaggccaaggccgagaaaggtatgcaccgtcctgcaggcttggagcccttccaatgccgc
aagctgggtctgataggcgcaggcatgatgggcgcgggcattgccttggtggccgcccag
cgcggtattcaggtggtgctgatagaccgggatcaggcggcagcggacaagggcaagcag
tactccgagaagacgctggccaggcaggtggacaaggggcgccagagccgcgagaaggcc
gatgccatcctcgcccgcatcacgcccggcaccgattacgagctgctgcgcgatgccgat
atggtggtcgaagccgtgtttgaagaccgagccatcaaggctgaagtgacccgcaagctg
gacgccgtgctgccgcctggctgcgtgctggccagcaacacctcggcactgcccatcagc
ctgctggcgcaggcgagcgacaggcccgatcgcttcatcggtctgcatttcttctcgccg
gccgacaagatgccgctggtggaagtcattcgcggcaagcagacatcggatgccacgctg
gcgcaggcactggatttcgtggctcagctcaagaagacgcccattgtcgtcaacgacaag
cgcggctttttcaccagccgcttcatcggcgcgtttgtggatgacgccatcggcatggtg
gcagaaggcattgcccctgcattgatagagaactgtgcaaagcatgcgggcatgcccgtg
gggccgctggcgattaccgacgagctgtcgattgatctgtccaagcatgcgggcgaatcc
caggccaaggagttcccagaggaatacaagcctggtcgctccgtgccggtgatcggcaag
ctgttcgagctgggccgcctgggccgcaaggtgggcaagggcttctatgactacgatgaa
agcggcaagcgcatctggccgggcctggccgagcattacccgctgaaagccacgcagccc
agtgcgcatgacctcaagcagcgcattctctatgtgcaggccgtcgaaggagcgcgcgcc
atggaggagggtgtgctgctggcgccggccgatggcgacatcggctcgattctgggggtg
ggctttcccgtctataccggcggccccttctgctttatcgacggcataggtctggcgcag
ttcgtggccgaggccgatcgcctggcagatctgtttggcgagcaactgcgcccgccacag
ctgctgcgggatatggcggccaagggccagaccttctacggcaagagcgcaagagcctga

DBGET integrated database retrieval system