KEGG   Comamonas testosteroni CNB-2: CtCNB1_1358Help
Entry
CtCNB1_1358       CDS       T01109                                 

Definition
fumarate reductase/succinate dehydrogenase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CtCNB1_1358
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     CtCNB1_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538483..1540219
Genome map
AA seq 578 aa AA seqDB search
MSNFKKHVSTINPVGAVLDVRSADEVQWSDASDVVVVGWGGAGASAAIEAREQGAEVLVI
DRFSGGGASVLSGGVVYAGGGTRYQKEAGFEDSPEAMTAYLKHEVNGVVSDETLARFSRD
SVANLNWLEKQGATFASTMPAYKTSYPTDGLYLYYSGNEVVPAYGNPQLVKKPAPRGHRV
VAKGQSGATFFAALQKSTLAHGARTLTQARVQRLVREKDSGRVLGVEVMVLPEGDPRTER
HKKLDELVAKWRLYQAPRAQAGRREAAQIESEIGEKRYIRARKGVVLSTGGYIFNSELLE
RHAPAYKPGWLTGAAGCDGSGLRLGQSVGGIAQDLNNISAWRFITPPSVWPKGLVVNTKG
ERFCNEQVYGAKLGYEMMEKQGGQAWLIIDSKLRRQAAWQCLFGGLWAFQSMPALALMYK
VAIKGKSVADLAKKLRMDATVLQLQFDRANAAARGEIEDPLGKSQDMRHEFKGGSLFAID
ISINQKMFPLAVLSLGGLKVNEDNGAVIDGAGYDIPGLYAAGRTAIGVASSRYVSGLSLA
DCVFSGRRAGKAAALEGGEPPAAQAVCPQASAVESVSS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatttcaaaaagcatgtcagcaccatcaatcctgtgggtgcagtcttggatgtg
cggtcggccgatgaggttcagtggtccgatgccagcgatgtggtggtggtcggctgggga
ggcgctggtgccagtgcagcgattgaggcgcgcgagcagggggccgaagttctggtgata
gaccgcttcagcggcggtggtgccagtgtgctgtcgggtggtgtggtctatgccggtggc
ggtaccaggtaccagaaggaggcgggcttcgaggactcacccgaagccatgactgcctac
ctcaagcatgaggtcaatggtgtggtcagtgacgagacactggctcgcttcagccgcgac
agcgtggccaacctgaattggctggaaaagcagggcgctacctttgcgtcgaccatgcct
gcgtacaagacctcctatccgaccgatggcctgtatctgtactactcgggcaacgaggtg
gtgcccgcctacggcaacccgcaactggtcaagaagcccgctccgcgcggtcatcgcgta
gtggccaaggggcagtcgggagcgacgttctttgccgcgctgcaaaaatccacattggcg
cacggagcccgcacattgacgcaggcccgcgtccagcgcctggtgcgcgagaaggacagt
ggccgtgtattgggcgtggaggtgatggtgttgcccgaaggcgatccacgtaccgaacgc
cacaagaagctcgatgagctggtggccaagtggcgtttgtatcaggcaccacgtgcccag
gcgggtcgtcgtgaagctgcgcagatcgaaagcgagatcggcgagaagcgctacatccgt
gctcgcaaaggtgtggtgctgtccactggcggctatatcttcaattcggagttgctggaa
cggcatgcgccggcttacaagcccggttggctgaccggtgctgcgggctgcgatggctct
ggtctgcgcctcgggcaatccgtgggagggatcgctcaggatctgaacaatatctcggcc
tggcgcttcatcacgccaccctcggtctggcccaagggtctggtggtcaacaccaaaggc
gagcgtttctgcaatgaacaggtctacggtgccaagctcggctacgagatgatggaaaag
caggggggacaggcttggctcatcattgatagcaagctgcgcaggcaggctgcgtggcag
tgcctgtttggcggtttgtgggccttccagtccatgcccgcgctggcgctgatgtacaag
gtcgcgatcaagggcaaatctgtcgccgatctggccaaaaagcttcgcatggatgcaaca
gtgctgcagctccagttcgatcgcgccaatgccgctgcacgcggtgagatcgaagacccg
ttgggcaagtcccaggacatgcgccatgagttcaagggcggctcgctgtttgccatcgat
atctccatcaaccagaagatgttcccgctggccgtcctgagtctggggggcctcaaggtc
aacgaggacaacggtgcagtgattgacggtgccggctatgacattcccgggctgtatgcc
gcggggcgcaccgccattggtgtggcttcctcgcgttatgtgagcggcttgtccctggcc
gactgcgtgttctcgggccgccgagcgggcaaggcggctgcactggaagggggcgagccc
cctgctgcccaggcagtgtgtccgcaggcaagcgctgtggagagcgtcagttcctga

DBGET integrated database retrieval system