KEGG   Comamonas testosteroni CNB-2: CtCNB1_1397Help
Entry
CtCNB1_1397       CDS       T01109                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_1397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_1397
   00620 Pyruvate metabolism
    CtCNB1_1397
   00640 Propanoate metabolism
    CtCNB1_1397
  Energy metabolism
   00680 Methane metabolism
    CtCNB1_1397
Enzymes [BR:ctt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CtCNB1_1397
Lipid biosynthesis proteins [BR:ctt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CtCNB1_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581411..1583405
Genome map
AA seq 664 aa AA seqDB search
MSAATSTIESVLVENRVFPPPADFAAKARISGMAQYQALCDEAERDYEGYWARLARENVQ
WTKPFTQVLDQSNPPFYKWFADGELNASANCLDKHMGTPVENKTAIIFEADGGEVTKVTY
KELLARVSQFANALKARGVQKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKA
VQERIVDVGASLVVTSNYQMRGGKELPLKAIVDDALALGGCEAVKSVLVYERTATACNMV
AGRDISFTEALAGQSTECEAVPVNAEHPLFILYTSGSTGKPKGVQHATGGYVLWAKQTFE
WTFDARDSDVFWCTADIGWITGHSYVAYGPLAAGATQIVFEGVPTFPNAGRFWQMIERHQ
CSIFYTAPTAIRSLIKAADSDPSVHPKNWNLSSLRLLGSVGEPINPEAWMWYHKHVGGER
CPIVDTFWQTENGGHMITPLPGATPLVPGSCTLPLPGITAAIVDEAGNEIPNGAGGILVV
KKPWPSMIRTIWGDPERFKKSYFPEELKGYYLAGDGAVRSEDRGYFRITGRIDDVLNVSG
HRMGTMEIESALVAKTDLVAEAAVVGRPDDLTGEAICAFVVLKRGKPTGEEARQIATELR
NWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQL
SETN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcgacatcaaccatcgaatccgtgctggtggaaaaccgtgtgttcccgccc
cctgcggatttcgccgccaaggcccgcatctcgggcatggcgcaataccaggccctgtgc
gatgaagccgagcgcgactatgaaggctattgggcacggctggcccgcgagaacgtgcag
tggaccaagcccttcacccaggtgctggaccagagcaacccgcctttctataaatggttt
gccgacggcgagctcaacgccagcgccaactgcctggacaagcacatgggcacgcccgtg
gagaacaagacggccatcatctttgaagcagacggcggcgaggtcaccaaggtcacttac
aaagagttgctcgcccgcgtgagccagttcgccaatgcgctcaaggcgcgcggcgtgcaa
aagggcgatcgcgtgctgatctacatgcccatgactatcgagggtgtggtggccatgcag
gcctgcgcacgcatcggcgccacgcattccgtggtgttcggcggcttctcggccaaggcc
gtacaggagcgcattgtggacgtgggtgccagtctggtcgtcacttccaactaccagatg
cgcggcggcaaggagttgccgctcaaggccatcgtcgacgacgcgcttgcgctgggcggc
tgcgaagccgtcaagagcgtgttggtctatgagcgcacggccactgcctgcaatatggtc
gcgggccgcgacatcagcttcaccgaggcattggccggccagtccaccgagtgcgaagcc
gtgcccgtcaatgccgagcacccgctcttcatcctctacaccagcggctccaccggcaag
cccaagggcgtgcagcatgccaccggcggctatgtgctgtgggccaagcagaccttcgaa
tggactttcgatgccagggacagcgatgtcttctggtgcacggccgatatcggctggatc
accggccacagctatgtggcctatggcccgctggcggccggtgccacgcagatcgtcttc
gaaggcgtgccgaccttccccaatgcgggccgcttctggcagatgatagagcgccaccag
tgcagcatcttctacacggcacccacggccatacgctcgctgatcaaggcggcggactcc
gaccccagcgtccacccgaagaactggaatctgtccagcctgcgtctgctgggctcggtg
ggcgagcccatcaaccccgaagcctggatgtggtatcacaagcatgtgggcggcgagcgc
tgccccatcgtagacaccttctggcagaccgagaacggcggccacatgatcacaccgctg
cccggtgccacacctctggtgcccggctcctgcaccctgcctctgcccggcatcacggcg
gccatcgtcgacgaggccggcaatgagatccccaatggcgccggcggcatcctggtggtg
aagaagccctggccctcgatgattcgcaccatctggggcgaccccgagcgcttcaagaag
agctacttccccgaagagctcaagggctactacctggccggcgacggcgccgtgcgcagc
gaggatcgcggctatttccgcatcacaggccgtatcgacgatgtgctcaatgtctcgggc
caccgtatgggcaccatggaaatcgagtcggccctggtggccaagaccgatctggtggcc
gaggccgccgtggtcggccgtcccgacgacctgaccggcgaagccatctgcgcctttgtg
gtgctcaagcgcggcaagcccacgggcgaggaagccaggcagattgcgaccgagctgcgc
aactgggtggccaaggagatcggcccgattgccaagcccaaggacatccgcttcggcgac
aacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctcgctggccaag
ggagaagcgattacccaggacaccagcactctggagaatcccgcgatcctcgagcaattg
tcggagaccaattga

DBGET integrated database retrieval system