KEGG   Comamonas testosteroni CNB-2: CtCNB1_1622Help
Entry
CtCNB1_1622       CDS       T01109                                 

Definition
putative Cytochrome c
Orthology
K08738  
cytochrome c
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CtCNB1_1622
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1837621..1838019)
Genome map
AA seq 132 aa AA seqDB search
MNTERWLLLGMLSFAATVHAAPDKLPGEQIYTRCAACHALAYDRVGPHHCGLLGRRAGTV
PGFAYSNAMKNSGFIWDEKTLDRFLTQPMKVLPGTTMTYAGIPDPKERSDLIAYLKQAND
SRECHSLRALPH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaacggtggctgctgcttggcatgctgtcgttcgcggcgacagtgcatgca
gcacctgacaaacttcctggcgagcagatatacacccgctgtgcggcctgccatgcgctg
gcatatgaccgagtgggaccgcatcattgcggcctgttgggacggcgtgcaggcacggtt
cccggctttgcttactcgaatgccatgaagaattccggcttcatctgggacgaaaaaaca
ctcgaccgtttcctgacccagcccatgaaggtgctaccaggtacgacaatgacgtacgcc
ggaatccctgaccccaaggagcgtagcgacttgattgcctacctcaagcaagccaacgat
tcacgagagtgtcattcccttcgagcactcccgcattga

DBGET integrated database retrieval system