KEGG   Comamonas testosteroni CNB-2: CtCNB1_1632Help
Entry
CtCNB1_1632       CDS       T01109                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CtCNB1_1632
DNA repair and recombination proteins [BR:ctt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CtCNB1_1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1849611..1850201
Genome map
AA seq 196 aa AA seqDB search
MSDVQSLDTLIEALRRLPGVGIKSAQRMAFHLLQRDQAGALQLARALDSAVNSVHHCERC
HTFTEGAICSICDDAGRDGARLCVVEAPADLAAMERTGAYQGYYYVLMGRLSPLDGVGPK
EIGMKQLLERACDGVVQEVILATSFTAEGEATAHAVSEALKSRGILVTRLARGVPIGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatgtgcaatctctggacaccttgatcgaggccttgcgccgactgccgggtgtg
ggcatcaagtcggcgcagcgtatggcgtttcatttgctgcagcgtgatcaggctggtgcg
ctgcagctggcgcgggcgctggactcggcggtgaactctgttcatcactgcgagcgctgc
catacgtttaccgaaggcgccatctgcagcatctgtgatgacgccgggcgagacggggct
cggctgtgcgtggtcgaggctccggccgatctggctgccatggagcgcacgggggcctat
cagggctattactatgtgctgatggggcggctgtccccgctcgacggggtgggccccaag
gaaatcggcatgaagcagttgctggagcgtgcctgtgatggcgtggtgcaggaggtgatt
ctggccaccagcttcacggcagagggcgaggcgacggcccatgctgtcagcgaggcgctc
aagtcgcgtggcattctggtcacgcggctggcgcgtggcgtgccgataggcagcgaactt
gaatatgtggatctcggcactattgcccatgcgctggtggacaggcgctga

DBGET integrated database retrieval system