KEGG   Comamonas testosteroni: CtCNB1_1632Help
Entry
CtCNB1_1632       CDS       T01109                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ctt  Comamonas testosteroni
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ctt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1849611..1850201
Genome map
AA seq 196 aa AA seqDB search
MSDVQSLDTLIEALRRLPGVGIKSAQRMAFHLLQRDQAGALQLARALDSAVNSVHHCERC
HTFTEGAICSICDDAGRDGARLCVVEAPADLAAMERTGAYQGYYYVLMGRLSPLDGVGPK
EIGMKQLLERACDGVVQEVILATSFTAEGEATAHAVSEALKSRGILVTRLARGVPIGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatgtgcaatctctggacaccttgatcgaggccttgcgccgactgccgggtgtg
ggcatcaagtcggcgcagcgtatggcgtttcatttgctgcagcgtgatcaggctggtgcg
ctgcagctggcgcgggcgctggactcggcggtgaactctgttcatcactgcgagcgctgc
catacgtttaccgaaggcgccatctgcagcatctgtgatgacgccgggcgagacggggct
cggctgtgcgtggtcgaggctccggccgatctggctgccatggagcgcacgggggcctat
cagggctattactatgtgctgatggggcggctgtccccgctcgacggggtgggccccaag
gaaatcggcatgaagcagttgctggagcgtgcctgtgatggcgtggtgcaggaggtgatt
ctggccaccagcttcacggcagagggcgaggcgacggcccatgctgtcagcgaggcgctc
aagtcgcgtggcattctggtcacgcggctggcgcgtggcgtgccgataggcagcgaactt
gaatatgtggatctcggcactattgcccatgcgctggtggacaggcgctga

DBGET integrated database retrieval system