KEGG   Comamonas testosteroni CNB-2: CtCNB1_1805Help
Entry
CtCNB1_1805       CDS       T01109                                 

Definition
Malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CtCNB1_1805
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CtCNB1_1805
Enzymes [BR:ctt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CtCNB1_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046088..2047503
Genome map
AA seq 471 aa AA seqDB search
MGWAAEWIEQTKLWVRGAEGEKGDAQHRPLAQRLEATLRRGEEALSPRELRRLLLDMQQV
ADTALSDVEGGRHAQLLMDWYAKADLAARKDFWLLAIEKFGPDAKALQAARERYDKAGSD
VERGEAEMSLRRALVSSRTRLLQRFAQPKGGMGFLVDMRAELLALPKAEQHYVALDAELE
HLFSSWFDVALLELRSLNWDSPASLLEKLIKYEAVHDIRSWADLKNRLDSDRRCYGFFHP
RMPNVPLIFVEVALLDKMAGSMAPLLDEAAAAADLAKANTAIFYSISNTQTGLKGVSFGD
SLIKHVVETLTQEFPKLKQFATLSPIPGLRSWLSKNGDAALAELDDKQKAALEKVAGGVS
AAQLLAALDDPGSLPEKSVVRQAAMFCAARYLGRETAKGRPLDAVARFHLGNGARVERLN
WAADLSSKGLKQSMGLMVNYLYDLKRLDKHRSLLAQSKIPVSSEIESLCKG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggggtgggcagccgagtggattgagcaaaccaagctgtgggtgcgcggtgccgagggc
gagaagggcgacgcccagcatcgcccgctggcgcaacgcctggaggccaccttgcgtcgt
ggggaggaggcgctgtcgccgcgcgagctgcgccgcttgctgctggacatgcagcaggtg
gcggataccgcgctcagcgacgtggagggcggccgtcatgcgcaactgctgatggattgg
tatgccaaggccgatctggccgcgcgcaaggacttctggctgctggcgatcgaaaagttc
ggccccgatgccaaggccctgcaggcggcccgcgagcgctacgacaaggcgggcagcgat
gtggagcgcggcgaggccgagatgagcctgcgccgcgccctggtttcatcgcgcacgcgg
ctgctgcagcgttttgcccagcccaagggcggcatgggctttctggtcgacatgcgcgcc
gagttgctggccttgcccaaggcggagcagcactatgtggcgctggacgccgagctggag
catctgttttccagctggttcgatgtggccttgctggagctcagaagcctgaactgggat
tcgcccgcatcgctgctcgaaaagctgatcaagtacgaggctgtgcacgacatccgcagc
tgggccgatctgaagaatcgcctcgacagcgaccgccgctgctatgggttctttcacccg
cgcatgcccaatgtgccgctgatctttgtggaggtggcactgctggacaagatggcaggc
agcatggctccgttgctggacgaggccgcagcggctgccgatctggccaaggccaacacc
gccatcttctattccatcagcaacacccagaccggactcaagggcgtgagcttcggcgat
tcgctcatcaagcatgtggtggagacgctcacccaggagtttcccaagctcaagcagttc
gccacgctgtcgccgattccgggactgcgcagctggctgagcaagaacggcgatgcggcg
ctggcggagctcgacgacaagcaaaaggcagccctggagaaggtcgccggcggagtgagt
gccgcgcaattgctggccgcgctggacgatccgggctcgctgccggagaaatcggtggtg
cgtcaggccgccatgttttgcgccgcgcgctatctgggtcgggaaactgccaaggggcgt
ccgctggatgccgtggcacgctttcaccttggcaacggtgcgcgcgtggagcgcctgaac
tgggcggcagacctgtcgtccaaggggctcaagcaatccatggggctgatggtcaactat
ctgtatgacctcaagcgcctggacaagcaccgcagcctgttggcgcagagcaagattccc
gtttcctcggagatcgaatcgctgtgcaagggttga

DBGET integrated database retrieval system